KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA2402Help
Entry
SA2402            CDS       T00051                                 

Definition
acetate-CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SA2402
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA2402
   00620 Pyruvate metabolism
    SA2402
   00640 Propanoate metabolism
    SA2402
  Energy metabolism
   00680 Methane metabolism
    SA2402
Enzymes [BR:sau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SA2402
Lipid biosynthesis proteins [BR:sau01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SA2402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2691272..2692891)
Genome map
AA seq 539 aa AA seqDB search
MYERKLVMQKSALFAPEKYNIISEIEKYSHIPDKKAILYHNTEGEDISVTYQQLIEQSNK
VGNVLASHGLSKGDKVLIMMPRSIATYELYIAALKLGVAIIPCSEMLRTKDLQYRITHGE
INAVIALEPFTVEFEKIKEYDALTKFVIAGQKDGWISLEAEKENASNKLEMADTTRDDMA
ILSYTSGTTGNPKAVTHCHGWGFAHLQMAPKHWLCINEDDLVWATAAPGWQKWVWSPFLS
VLGSGATAFVFNGRFSPETYLELLQKYQINVLCCTPTEYRMMAKLQNLNDYDLTHLHSAV
SAGEPLNREVVEQFKKYFNLTVRDGYGQTESTLLIGFLKDTPQRIGSMGKGIPGSSVTVV
DDEGNSVPANTKGNIAVPLDLPALFKGYYKEPERTAKAQTGKYYITGDLAHVDDDGYFWF
EGRRDDIIISSGYTIGPFEVEDALTNHPAVKECAVVAKPHDIRGNIVKAFVILQDHTAGD
DTLVKELQQFVKNEVAPYKYPREIEFVDDLPKTNSGKIRRVELRDSEIEKWQQQKDSNQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaaggaagttagttatgcaaaagtcagctctattcgcgcctgaaaaatataac
attatttcggaaatcgaaaaatatagccacataccagataaaaaggcaattttatatcat
aatactgaaggcgaagatatatcagtcacttaccaacagctcattgaacagtctaataaa
gtaggtaatgttttagcatcgcacggtttatctaaaggcgataaagtactcattatgatg
ccacgatctattgcgacgtatgaattatatattgctgctttaaaattaggtgttgcaatc
attccatgttctgaaatgctaagaactaaagatttacaataccgtatcacgcacggtgaa
ataaatgcagttattgcactagagccattcacagttgaatttgaaaaaattaaagaatat
gatgcgttaactaaatttgttattgccggtcaaaaagatggatggatttcacttgaagct
gaaaaagaaaacgcaagtaacaaactagaaatggcagatacgacgcgtgatgatatggcg
attctgtcatatacatctggtacaactggcaatcctaaagccgttacacattgtcatgga
tggggatttgcacatttacaaatggcaccaaaacattggttatgtattaatgaagatgac
ttagtttgggcaacagcagcaccaggttggcaaaaatgggtatggagtcctttcttatct
gtattaggttcaggtgcaactgcttttgtatttaatggaaggttcagtcctgaaacatac
ttagaattgcttcaaaaatatcaaattaatgttttatgttgtacaccgacagaatatcgt
atgatggctaaattacagaacttaaatgattatgacttaacgcatttacatagtgccgtt
tctgcaggtgagccactaaatcgagaagtagttgaacaattcaagaaatactttaattta
actgtaagagatggatatggccagactgaaagtaccttgcttataggctttttaaaagat
acaccacagaggattggatcaatgggtaaaggcattccaggtagttcggtcactgtagta
gatgatgaggggaatagcgtacctgctaatacgaaagggaatattgcagtaccacttgat
ttgccagcacttttcaaagggtattataaagagccagaacgtacggcgaaagcgcaaaca
ggtaaatactacatcactggtgacttagctcatgtagatgatgatggttatttctggttt
gaaggacgtcgagatgacattattattagttcaggctatacgattgggccttttgaagtt
gaagatgcgttaacgaatcatccagccgttaaagaatgtgctgtagtagcaaaacctcat
gatatacgaggaaatattgttaaagcattcgttattttacaggaccatactgcgggtgat
gatacgttagttaaagaactacaacaatttgttaaaaatgaagttgcaccatataaatat
ccgagagagattgaattcgttgacgacttaccaaaaacaaactcaggtaaaattcgtcgt
gttgaactacgagattctgaaatagaaaaatggcaacaacaaaaagatagcaatcaataa

DBGET integrated database retrieval system