KEGG   Staphylococcus aureus 08BA02176: C248_0156Help
Entry
C248_0156         CDS       T02339                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
saub  Staphylococcus aureus 08BA02176
Pathway
saub00010  Glycolysis / Gluconeogenesis
saub00053  Ascorbate and aldarate metabolism
saub00071  Fatty acid degradation
saub00280  Valine, leucine and isoleucine degradation
saub00310  Lysine degradation
saub00330  Arginine and proline metabolism
saub00340  Histidine metabolism
saub00380  Tryptophan metabolism
saub00410  beta-Alanine metabolism
saub00561  Glycerolipid metabolism
saub00620  Pyruvate metabolism
saub00625  Chloroalkane and chloroalkene degradation
saub01100  Metabolic pathways
saub01110  Biosynthesis of secondary metabolites
saub01120  Microbial metabolism in diverse environments
saub01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C248_0156
   00053 Ascorbate and aldarate metabolism
    C248_0156
   00620 Pyruvate metabolism
    C248_0156
  Lipid metabolism
   00071 Fatty acid degradation
    C248_0156
   00561 Glycerolipid metabolism
    C248_0156
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C248_0156
   00310 Lysine degradation
    C248_0156
   00330 Arginine and proline metabolism
    C248_0156
   00340 Histidine metabolism
    C248_0156
   00380 Tryptophan metabolism
    C248_0156
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C248_0156
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C248_0156
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C248_0156
Enzymes [BR:saub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C248_0156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AFR72170
Position
167066..168553
Genome map
AA seq 495 aa AA seqDB search
MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVEVAQ
EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
KIYDQLVPRLQEAFSNIKVGNPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
KNIYIDTSNALKGLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaacgttcgagattatattgcagagaattatggtttatttatcaatggggaa
tttgttaaaggtagcagtgacgaaacaatcgaagtgaccaatccagcaactggagaaaca
ctatcacatattacaagagcaaaagataaagatgtcgatcatgcagtcgaagtggcgcaa
gaggcatttgaatcatggtcattaacttctaaatcagaacgtgcacaaatgttgcgtgat
attggtgataaattaatggcacaaaaagataaaattgcaatgattgaaacattaaataat
ggtaaaccgattcgtgagacaacagcaattgatattccatttgctgcaagacatttccat
tatttcgcaagtgttattgaaacagaagaaggtacagtgaatgatatcgataaagacaca
atgagtatcgtacgacatgagccgattggcgtcgtaggtgctgttgttgcttggaacttc
ccaatgctattagctgcatggaagattgcgccagccattgctgcaggtaatacaattgtg
attcaaccttcgtcttcaacaccattaagtttattggaagttgctaaaattttccaagag
gtattacctaaaggtgttgtcaatatactaacgggtaaaggttcagaatcaggtaatgca
attttcaatcatgatggtgtagataaattatcatttacgggctcaactgatgtaggttat
caagttgccgaagctgcagcaaaacatctagtacccgctacattagagcttggtggtaaa
agcgccaatatcatattagatgatgctaatttagaccttgcagttgaaggtattcagtta
ggtattttattcaaccaaggtgaagtatgtagtgcaggttctcgattattagttcatgaa
aaaatttatgatcaattggtgccacgtttacaagaggcattttcaaatattaaagttgga
aatccacaagatgaagctacacaaatgggtagtcaaactggtaaagatcaattagataaa
attcaatcatatattgatgcagctaaagaatcagatgcacaaattttagcaggtggacat
cgcttaactgaaaatgggttagataaaggattcttctttgagccgacattaattgctgtg
ccagacaatcatcacaaattagcacaagaagaaatatttggaccagtgttaacagtgatt
aaagtgaaggacgatcaagaagcaattgatatagctaatgattcagagtatggtttagct
ggcggcgtattttctcaaaatatcacacgtgcattaaatattgctaaagctgttcgtaca
ggacgtatttggattaatacttacaaccaagtaccagaaggcgcaccatttggtggttat
aaaaaatcaggtatcggtcgagaaacttataaaggtgcgttaagtaactatcaacaagtt
aaaaatatttatattgatacaagcaatgctttaaaaggtttgtactag

DBGET integrated database retrieval system