KEGG   Staphylococcus aureus 08BA02176: C248_0156Help
Entry
C248_0156         CDS       T02339                                 

Definition
aldehyde dehydrogenase
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
saub  Staphylococcus aureus 08BA02176
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C248_0156
   00040 Pentose and glucuronate interconversions
    C248_0156
   00053 Ascorbate and aldarate metabolism
    C248_0156
   00620 Pyruvate metabolism
    C248_0156
  Lipid metabolism
   00071 Fatty acid degradation
    C248_0156
   00561 Glycerolipid metabolism
    C248_0156
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C248_0156
   00310 Lysine degradation
    C248_0156
   00330 Arginine and proline metabolism
    C248_0156
   00340 Histidine metabolism
    C248_0156
   00380 Tryptophan metabolism
    C248_0156
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C248_0156
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C248_0156
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C248_0156
Enzymes [BR:saub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C248_0156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
167066..168553
Genome map
AA seq 495 aa AA seqDB search
MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVEVAQ
EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
KIYDQLVPRLQEAFSNIKVGNPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
KNIYIDTSNALKGLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaacgttcgagattatattgcagagaattatggtttatttatcaatggggaa
tttgttaaaggtagcagtgacgaaacaatcgaagtgaccaatccagcaactggagaaaca
ctatcacatattacaagagcaaaagataaagatgtcgatcatgcagtcgaagtggcgcaa
gaggcatttgaatcatggtcattaacttctaaatcagaacgtgcacaaatgttgcgtgat
attggtgataaattaatggcacaaaaagataaaattgcaatgattgaaacattaaataat
ggtaaaccgattcgtgagacaacagcaattgatattccatttgctgcaagacatttccat
tatttcgcaagtgttattgaaacagaagaaggtacagtgaatgatatcgataaagacaca
atgagtatcgtacgacatgagccgattggcgtcgtaggtgctgttgttgcttggaacttc
ccaatgctattagctgcatggaagattgcgccagccattgctgcaggtaatacaattgtg
attcaaccttcgtcttcaacaccattaagtttattggaagttgctaaaattttccaagag
gtattacctaaaggtgttgtcaatatactaacgggtaaaggttcagaatcaggtaatgca
attttcaatcatgatggtgtagataaattatcatttacgggctcaactgatgtaggttat
caagttgccgaagctgcagcaaaacatctagtacccgctacattagagcttggtggtaaa
agcgccaatatcatattagatgatgctaatttagaccttgcagttgaaggtattcagtta
ggtattttattcaaccaaggtgaagtatgtagtgcaggttctcgattattagttcatgaa
aaaatttatgatcaattggtgccacgtttacaagaggcattttcaaatattaaagttgga
aatccacaagatgaagctacacaaatgggtagtcaaactggtaaagatcaattagataaa
attcaatcatatattgatgcagctaaagaatcagatgcacaaattttagcaggtggacat
cgcttaactgaaaatgggttagataaaggattcttctttgagccgacattaattgctgtg
ccagacaatcatcacaaattagcacaagaagaaatatttggaccagtgttaacagtgatt
aaagtgaaggacgatcaagaagcaattgatatagctaatgattcagagtatggtttagct
ggcggcgtattttctcaaaatatcacacgtgcattaaatattgctaaagctgttcgtaca
ggacgtatttggattaatacttacaaccaagtaccagaaggcgcaccatttggtggttat
aaaaaatcaggtatcggtcgagaaacttataaaggtgcgttaagtaactatcaacaagtt
aaaaatatttatattgatacaagcaatgctttaaaaggtttgtactag

DBGET integrated database retrieval system