KEGG   Staphylococcus aureus 08BA02176: C248_0870Help
Entry
C248_0870         CDS       T02339                                 

Gene name
est
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
saub  Staphylococcus aureus 08BA02176
Brite
Enzymes [BR:saub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     C248_0870 (est)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
882881..883621
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LQSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
KTEGAIYEGFLEYARNFKKYEGKDQETIDNEMHHFKPTETLKELSEALDTIKDQVDEVFD
PILVIQAENDNMIDPQSANYIYEHVDSDEKDIKWYSQSGHVITIDKEKEQVFDDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaagttaccaaagcctttcttttttgaggaaggtaaacgtgccgtgttatta
ctacatggttttacaggcaattcgtctgatgttcgtcaattaggtcgatttttacaaaag
aaaggttatacatcgtatgcaccacaatatgaaggtcatgcagcaccaccagaagagata
cttcaatcaagtccttttgtttggtttaaagatgccttagatggctatgactaccttgtt
gaacaaggttatgatgaaatcgttgttgctggcttgtcattaggtggcgattttgcatta
aaattaagcttaaatcgagatgtaaagggtattgtaacgatgtgtgctcctatgggtggc
aaaactgaaggtgccatttatgaaggctttttagaatatgcacgcaattttaaaaagtat
gagggtaaagatcaagaaacgattgataacgaaatgcatcatttcaaaccaactgaaact
ttaaaagaattaagtgaagcattagatacgattaaagatcaagttgatgaggtgtttgac
ccaattttagtgattcaagcagaaaacgacaatatgattgatccacaatccgcaaattat
atatatgaacatgtagactctgacgaaaaagatatcaaatggtatagtcagtcaggacat
gttattacaattgataaagaaaaagaacaagttttcgatgatatttatcaatttttagag
tcattagactggtcagaataa

DBGET integrated database retrieval system