KEGG   Staphylococcus aureus 08BA02176: C248_1334Help
Entry
C248_1334         CDS       T02339                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
saub  Staphylococcus aureus 08BA02176
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saub00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    C248_1334 (glpK)
Enzymes [BR:saub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     C248_1334 (glpK)
Exosome [BR:saub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C248_1334 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1345833..1347329
Genome map
AA seq 498 aa AA seqDB search
MEKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDANEIWTSVLAVMT
EVINENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQSICSELKQQGYE
QTFRDKTGLLLDPYFAGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGKAAHIT
DYSNASRTLMFNIHDLEWDDELLELLTVPKNMLPEVKASSEVYGKTIDYHFYGQEVPIAG
VAGDQQAALFGQACFERGDVKNTYGTGGFMLMNTGDKAVKSESGLLTTIAYGIDGKVNYA
LEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDSEAR
GAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGIDVQSLRVDGGAVKNNFIMQF
QADIVNTSVERPEIQETTALGAAYLAGLAVGFWESKDDIAKNWKLEEKFDPKMDEGEREK
LYRGWKKAVEATQVFKTE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatattttatctatagaccaaggaacaacaagctcaagagcgattttattc
aatcaaaaaggggaaattgcaggggtagcacaacgtgagtttaagcaatattttccacaa
tcaggttgggttgaacatgatgcaaatgaaatttggacatctgtgttagctgtaatgacg
gaagtaattaatgaaaatgatgttagagctgatcaaattgcaggtatcggtattacaaac
caacgtgaaacaacggttgtttgggacaaacatactggtcgcccaatttatcacgcaatt
gtttggcaatcacgtcagacacaatcaatttgttcagaattaaaacaacaaggatatgaa
caaacatttagagataagacaggattacttttagatccgtattttgcaggtacaaaagtt
aaatggattctagacaatgttgaaggtgcacgagaaaaagcagaaaatggcgatctatta
tttggaacgattgatacttggttagtatggaaattatcaggaaaagctgcgcatattact
gattattcaaatgcgagtcgtacattaatgtttaatatccatgatttagaatgggacgat
gagttattagaactacttacagtacctaaaaatatgttgccagaagttaaagcttcgagt
gaagtatatggtaagacaattgattaccacttctatggtcaagaagtaccaatcgctgga
gtagctggtgatcaacaagcagcattatttggacaagcttgcttcgaacgtggtgatgtg
aaaaacacatatggaactggtggcttcatgttaatgaatacaggtgacaaagcggttaaa
tctgaaagtggtttattaacaacaattgcttatggtattgatggaaaagtaaattatgcg
cttgaaggttcaatctttgtttcgggttcagcaatccaatggttacgtgatggattaaga
atgattaattcagcaccacaatcagaaagttatgcgacacgagttgactctactgagggt
gtttatgttgttccagcttttgtaggtttaggaacaccatattgggattctgaagcacgt
ggtgcgattttcggtttaacacgcggaactgaaaaagagcactttatccgtgcaacatta
gaatcattatgttaccaaactcgtgacgttatggaagcaatgtcaaaagactctggtatc
gatgtccaaagtttacgtgtcgatggtggtgcagttaagaataactttattatgcagttc
caagcagacattgttaatacttctgttgaaagacctgaaattcaagaaactacagcttta
ggtgctgcatatttagcaggtttagcagttggattctgggagagtaaagatgatatcgct
aaaaattggaaattagaagaaaaattcgatccgaaaatggatgaaggcgaaagagaaaaa
ttatatagaggttggaaaaaagctgttgaagcaacacaagtttttaaaacagaataa

DBGET integrated database retrieval system