KEGG   Staphylococcus aureus 08BA02176: C248_1408Help
Entry
C248_1408         CDS       T02339                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
saub  Staphylococcus aureus 08BA02176
Pathway
saub00400  Phenylalanine, tyrosine and tryptophan biosynthesis
saub01100  Metabolic pathways
saub01110  Biosynthesis of secondary metabolites
saub01130  Biosynthesis of antibiotics
saub01230  Biosynthesis of amino acids
Module
saub_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:saub00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C248_1408 (trpC)
Enzymes [BR:saub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     C248_1408 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh BBE AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AFR73398
Position
1423585..1424367
Genome map
AA seq 260 aa AA seqDB search
MTILEEIVEYKQSLLQNGYYQDKLSTLKSVNIQNKKSFINTIEQEPKLVIIAEIKSKSPT
VNDLPERDLSQQISDYEQYGANAVSILTDEKYFGGSFERLQELTTKTTLPVLCKDFIIDP
LQIDVAKQAGASMILLIVNILSDKQLRELYEYATSQSLEVLVEVHDREELDRAYKINPKL
IGVNNRDLKRFVTKVEHTNIILENKQPNHYYISESGIHDTSDVRKILHSGIDGLLIGEAL
MRCDNLSEFLPQLKMQKVKS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaattttagaagaaattgttgaatataaacagtcacttttacaaaatggctattac
caagacaaacttagcactttaaaaagtgtgaacattcagaataaaaaatcttttataaac
acaattgaacaggaaccaaagttagtaattattgcagaaattaaatcaaagagtcccaca
gttaatgacttacctgaacgagatttatctcaacaaatttctgattatgaacagtacggt
gcaaatgcagtttcaattttaacagatgaaaagtactttggagggagctttgaacgttta
caagaattaacaacaaaaacgacacttccagtattgtgtaaagactttattatagatccg
cttcaaattgacgttgctaaacaagctggtgcatctatgattttacttatagttaatatc
ttatctgataaacaattgagagagttatacgaatacgctacttctcaaagtttagaagta
ttggtggaagttcatgatcgtgaagaattagaccgtgcctataagattaatcctaaatta
atcggtgtaaataatcgtgatttaaaacgttttgttacaaaagtggaacatacaaatatt
attttagaaaataaacagccgaatcattattatatttcagaaagcggtattcatgatacc
tctgatgtaagaaaaatcttgcatagtggtatcgatggcttactaataggtgaggcgctt
atgcgttgcgacaatctatctgaatttttaccacaactaaaaatgcaaaaggtgaagtca
tga

DBGET integrated database retrieval system