KEGG   Staphylococcus aureus 08BA02176: C248_1451Help
Entry
C248_1451         CDS       T02339                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase E2 component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
saub  Staphylococcus aureus 08BA02176
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saub00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    C248_1451 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C248_1451 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    C248_1451 (odhB)
Enzymes [BR:saub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     C248_1451 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1466944..1468215)
Genome map
AA seq 423 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLA
SEGDTVEVGQAIAVIGEGSGNASKENSNDNTPQQNDETTNNKKEETTNKSADKAEVNQTN
DDNQQRVNATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQAPAKE
EKKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQF
MKDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF
VRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQA
AILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLL
LES
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaaagttccagaattagcagaatctattacagaaggtaccattgcagaa
tggttgaaaaacgtaggggatagcgtagaaaaaggtgaagctattcttgaattagaaact
gataaagttaatgtcgaagttgtatctgaagaagcaggtgtattatctgaacaacttgca
agtgaaggcgacactgtagaagttggacaagcaattgctgtcatcggcgaaggtagtggc
aatgcttctaaagaaaatagtaacgacaatactccacaacaaaatgatgaaacaacaaat
aataaaaaagaagaaacaacaaataaatcggcagataaagctgaagtcaatcaaacaaat
gatgataatcagcagcgtgttaatgctacgccttctgcgcgtcgatatgctcgtgaaaac
ggtgtgaatcttgctgaagtaagtccgaaaacaaatgatgttgttcgtaaagaagatatt
gataaaaaacaacaggcaccggcatcaacacaaacaacacaacaagcacctgcaaaagaa
gagaaaaaatacaatcaatatcctacaaaaccagtgattcgcgaaaaaatgtcacgcaga
aagaaaacagctgctaaaaaattattagaggtatctaataatacagctatgttaacaaca
tttaacgaagttgacatgacaaatgttatggaattgcgtaaacgtaagaaagaacaattt
atgaaagatcatgatggtactaaattaggatttatgtcattctttactaaagcttctgta
gcagctttgaaaaagtatccagaagttaatgcagaaatcgacggcgacgacatgattacg
aaacaatattatgacattggtgtagctgtttctacagatgatggactattagtaccattc
gtaagagattgtgataaaaagaattttgcagaaatcgaagcagaaattgctaatttagct
gttaaagcacgagagaaaaaacttggcttagatgatatggttaatggttcatttacgatt
acaaatggcggtatttttggatcaatgatgagtacgccaattatcaatggtaatcaagct
gcaatcttaggcatgcattcaattattacaagaccaattgcgattgatcaagatacaatt
gaaaatcgtccaatgatgtatattgcattaagctatgatcatagaattattgacggtaaa
gaagcagttggattcttaaaaacaattaaagaattaattgaaaacccagaagacttatta
ttagaatcttaa

DBGET integrated database retrieval system