KEGG   Staphylococcus aureus 08BA02176: C248_1661Help
Entry
C248_1661         CDS       T02339                                 

Definition
(GenBank) hypothetical protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
saub  Staphylococcus aureus 08BA02176
Pathway
saub03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:saub00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    C248_1661
Enzymes [BR:saub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     C248_1661
DNA repair and recombination proteins [BR:saub03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     C248_1661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 AAA T2SSE AAA_12 AAA_18 AAA_14 AAA_29 Mg_chelatase NTPase_1 TsaE Helicase_RecD ABC_tran HHH_3 UvrD_C 5_3_exonuc AAA_28 RsgA_GTPase Zeta_toxin AAA_22 AAA_16 DUF815 NACHT
Motif
Other DBs
NCBI-ProteinID: AFR73651
Position
complement(1695986..1698463)
Genome map
AA seq 825 aa AA seqDB search
MSDPTLFDYSMIKGTVEAILFQNSDNFYTVLKVDTIETNEDFDTMPTVVGFLPNIVEGDV
YTFKGQVVDHPRYGKQLKAETFEKEMPQTKEAIISYLSSDLFKGVGKKTAQNIVNTLGDN
AINDILDDHSVLEKVSGLSKKKQKQIAEQISANQESEKIMIRLHDLGFGPKLSMAIYQFY
LGDTLTILDRNPYQLIYDIKGIGFNKADQLARNIGIAYNDNERLKAALLYTLEEECIKQG
HTYLPINVVIDLTVDVLNYQDEEVIEPEKLDEMLQYLNEEKRLIIDNEQVAIPSLYYSEI
KSVQNLFRIKTHTNKLTEIEQSDLQMHIGEIEDANQVNYAASQKEALQTAINSKVMLLTG
GPGTGKTTVIKGIVELYAEIHGLSLDYDDYVNDDYPVVLAAPTGRASKRLQESTGLEAMT
IHRLIGWNQDTKPEDILENEINARLIIIDEMSMVDTWLFHQFLSAVPLDAQLIFVGDEDQ
LPSVGPGQVFKDLIESKAIPRVNLTEVYRQQDGSSIIELAHRMKLGQKIDITQRFHDRSF
INCQANQIPTVVEKVVTSAVNKGYTMADIQVLAPMYKGNAGIKRLNQVLQDILNPKKKDT
REIEFGDVVFRKGDKVLQLVNRPNDNIFNGDIGVIVGIFWAKENALNKDVLVVDFEGNEI
TFTKQDMMELTHAYCTSIHKSQGSEFPIVIMPIVKQYFRMLQRPILYTGLTRAKTSLVLL
GDPEAFDIGLKTNGQARLTQLCTLLKNYFNSEDEDMLENTATNDTVASQTTIDDQVEAPM
SSNDSEEVTSDSTKTDTNVLTEATMFKIDPMINMGEITPYDFIER
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaccctacactatttgattattcaatgatcaaaggtactgttgaagcgatattg
tttcaaaacagtgataatttttatacagtgcttaaagtagatactattgaaacaaatgaa
gactttgatacaatgccaactgttgtagggtttcttccgaatattgttgaaggcgatgtc
tacacatttaaagggcaggttgttgatcatccacgttatggtaaacaattaaaagcagaa
acttttgaaaaagaaatgccacaaacgaaagaagcaattataagttatttatcaagtgat
ttgtttaaaggtgtaggtaaaaagacagctcaaaatattgttaatacattaggtgacaat
gcgataaatgatatattagatgaccattcagttctagaaaaagtttcgggattatctaaa
aagaaacagaaacaaattgcagaacaaatttcagcaaatcaagaatctgaaaaaataatg
attcgtttacatgatttagggtttggtcctaaactttcaatggcaatttatcagttttat
ctcggtgatacactgactattttagatcgaaatccatatcaattgatttatgatattaaa
ggtattggttttaataaagcagatcaacttgctagaaatattggtatcgcttataacgat
aatgaacgattaaaagctgcgttgctctatacgttagaagaagaatgtattaaacaggga
catacatatttgcctatcaatgttgttatagatttaacggttgatgtattaaattatcaa
gatgaagaggtcatcgaacctgaaaaattagacgaaatgttgcaatacttaaatgaggaa
aaacgactaattattgacaatgaacaagttgcaattccaagtttgtattattctgaaatc
aaaagtgttcaaaacttattcagaataaagacgcatacaaataaacttacagaaattgaa
cagtcagatttacaaatgcatattggtgaaatagaagatgcgaatcaagtgaactatgca
gcttcacaaaaagaagctttgcaaacggctatcaattctaaggtgatgctattaaccggt
ggaccgggaacaggaaagacgacagtaattaaaggcattgtagaattatatgctgagatt
catggcttatcattagattatgatgattatgtcaatgatgattatccagttgtattagca
gcgccaacaggaagagcgtccaagagactacaagagtcaactggattagaagctatgacg
attcatcgtttaataggttggaatcaagacacaaagccagaggatatattagaaaatgaa
ataaacgcacgacttataatcattgatgagatgtctatggtagatacttggttgttccac
caatttttaagtgcagttcctttagatgcacaattgatatttgtaggtgatgaggaccaa
ttgccttctgtaggtcctggtcaagtatttaaagatttaattgaatcgaaagctatacca
cgagttaatctgactgaagtatatcgtcaacaagatggttcaagcattatagaattagca
catcgaatgaagttgggtcagaaaattgatattacacagcgttttcatgatagaagtttt
attaactgtcaggcaaaccaaataccaacagttgttgagaaggtagttactagtgctgtt
aataaagggtatactatggctgatattcaagtgcttgcaccaatgtataaaggaaatgct
ggtattaaacgtttaaatcaagttttacaagatattttaaaccctaaaaagaaagacaca
cgtgaaattgagtttggtgatgtagtctttagaaaaggtgacaaagtattacaacttgtt
aataggccaaatgataacatatttaatggtgacataggagttattgttggtattttttgg
gcgaaagaaaatgcccttaataaagatgtgcttgttgtggattttgaaggtaatgaaatt
acatttacgaaacaagatatgatggaattaacacatgcatattgtacatcaatccataaa
tcgcaaggttcagaatttcctattgttatcatgcctattgttaaacagtattttagaatg
ttacaaagaccgatattatatactggtttaactagagcgaaaacgagtttagttttactt
ggtgatccagaagcatttgatattggattgaaaacaaatggtcaagcgcgtttaacacaa
ttatgtacattgttgaaaaattattttaattcagaagatgaagacatgctggaaaacaca
gcaactaatgatacagtagcttcacaaacgacaatagatgatcaagtagaagcgccaatg
tcatcgaatgatagtgaagaagttacgtctgattcaacaaaaacagatacaaatgtatta
acggaagctacaatgtttaaaattgacccaatgattaatatgggagaaatcacgccatat
gactttatagaacgttga

DBGET integrated database retrieval system