KEGG   Staphylococcus aureus 08BA02176: C248_1740Help
Entry
C248_1740         CDS       T02339                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
saub  Staphylococcus aureus 08BA02176
Pathway
saub00010  Glycolysis / Gluconeogenesis
saub00030  Pentose phosphate pathway
saub00051  Fructose and mannose metabolism
saub00052  Galactose metabolism
saub00680  Methane metabolism
saub01100  Metabolic pathways
saub01110  Biosynthesis of secondary metabolites
saub01120  Microbial metabolism in diverse environments
saub01130  Biosynthesis of antibiotics
saub01200  Carbon metabolism
saub01230  Biosynthesis of amino acids
saub03018  RNA degradation
Module
saub_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
saub_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:saub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C248_1740 (pfkA)
   00030 Pentose phosphate pathway
    C248_1740 (pfkA)
   00051 Fructose and mannose metabolism
    C248_1740 (pfkA)
   00052 Galactose metabolism
    C248_1740 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    C248_1740 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    C248_1740 (pfkA)
Enzymes [BR:saub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     C248_1740 (pfkA)
Protein phosphatases and associated proteins [BR:saub01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     C248_1740 (pfkA)
Messenger RNA biogenesis [BR:saub03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     C248_1740 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFR73730
Position
complement(1781651..1782619)
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDT
IQRGGTFLYSARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQ
TIGIPGTIDNDINGTDFTIGFDTALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLAL
WAGLSVGAETIVVPEVKTDIKEIADKIEQGIKRGKKHSIVLVAEGCMTAQDCQKELSQYI
NVDNRVSVLGHVQRGGSPTGADRVLASRLGGYAVDLLMQGETAKGVGIKNNKIVATSFDE
IFDGKDHKFDYSLYELANKLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgcagttttaactagtggtggagattcacctggaatgaatgctgccgta
agagcagttgttcgtacagcaatttacaatgaaattgaagtttatggtgtgtatcatggt
taccaaggattgttaaatgatgatattcataaacttgaattaggatcagttggggatacg
attcagcgtggaggtacattcttgtattcagcaagatgtccagagtttaaggagcaagaa
gtacgtaaagttgcaatcgaaaacttacgtaaaagagggattgagggccttgtagttatt
ggtggtgacggtagttatcgcggtgcacaacgcatcagtgaggaatgcaaagaaattcaa
actatcggtattcctggtacgattgacaatgatatcaatggtactgattttacaattgga
tttgacacagcattaaatacgattattggcttagtcgacaaaattagagatactgcgtca
agtcacgcacgaacatttatcattgaagcaatgggccgtgattgtggagatctagcatta
tgggctggattatcagttggtgctgagacaattgtagttccagaagtgaaaacagatatt
aaagaaatagctgataaaattgaacaaggtattaaacgtggtaagaaacactcaatcgtt
cttgtagcagaaggttgtatgactgcgcaagattgtcaaaaagaattatcacaatacatc
aatgttgataatagagtgtctgtgttaggtcacgttcaacgtggtggtagcccaacaggt
gcggatagagttttagcatcacgattaggtggatatgcggtagacttattaatgcaaggt
gaaacagctaaaggtgttggaattaagaacaataaaattgtagcaacatcttttgatgaa
atttttgatggtaaagatcataaatttgattatagtctatatgaacttgctaacaagtta
tctatataa

DBGET integrated database retrieval system