KEGG   Staphylococcus aureus 08BA02176: C248_2551Help
Entry
C248_2551         CDS       T02339                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
saub  Staphylococcus aureus 08BA02176
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:saub00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    C248_2551 (gtaB)
   00052 Galactose metabolism
    C248_2551 (gtaB)
   00500 Starch and sucrose metabolism
    C248_2551 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    C248_2551 (gtaB)
Enzymes [BR:saub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     C248_2551 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2541111..2541977)
Genome map
AA seq 288 aa AA seqDB search
MKKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRH
KRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQF
IGNEPFAVLLGDDIVESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNG
RQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNND
NQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKELGL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaataaaaaaggcaatcattcccgctgctggtttagggactagatttttacca
gcaactaaagcgatgccaaaggaaatgcttcctatcttagataaacccacaatacaatat
atcgttgaagaagctgcaagagctggaattgaagatattattatagtgacaggtcgccac
aaacgcgcgattgaagatcattttgatagtcaaaaagaattagaaatggttttaaaagaa
aaaggtaaatctgaattactagaaaaagttcagtattcaacggaacttgcgaatattttt
tatgtaaggcagaaagaacaaaaaggtttggggcatgcgattagttctgcgcgtcaattt
atcggcaatgaaccatttgcggtattattaggtgacgatattgttgaatctgaagtgcca
gcagtgaaacagttgattgacgtttatgaagaaacggggcactcagttataggtgtccaa
gaagttccggaagcagatactcatcgttatggaattattgatccattaactaaaaatgga
cgtcagtatgaagtgaaaaagtttgttgaaaagccagcacaaggtacggcaccatcaaac
ctagctattatggggcgatatgtattaacgcctgaaattttcgattatttaaaaacgcaa
aaagaaggcgcaggtaacgaaattcagttaacagatgcgattgagcgtatgaataatgat
aaccaagtgtatgcatatgacttcgaaggcgaacgttatgacgttggagaaaaattaggc
tttgttaaaactaccatagaatatgcattgaaagatgacagtatgcgagaagaattaaca
cgatttattaaagaattaggtttataa

DBGET integrated database retrieval system