KEGG   Staphylococcus aureus CA-347: CA347_1273Help
Entry
CA347_1273        CDS       T02702                                 

Definition
catalase family protein
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
sauc  Staphylococcus aureus CA-347
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sauc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CA347_1273
  Amino acid metabolism
   00380 Tryptophan metabolism
    CA347_1273
Enzymes [BR:sauc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     CA347_1273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1340868..1342385
Genome map
AA seq 505 aa AA seqDB search
MSQQDKKLTGVFGHPVSDRENSMTAGPRGPLLMQDIYFLEQMSQFDREVIPERRMHAKGS
GAFGTFTVTKDITKYTNAKIFSEIGKQTEMFARFSTVAGERGAADAERDIRGFALKFYTE
EGNWDLVGNNTPVFFFRDPKLFVSLNRAVKRDPRTNMRDAQNNWDFWTGLPEALHQVTIL
MSDRGIPKDLRHMHGFGSHTYSMYNDSGERVWVKFHFRTQQGIENLTDEEAAEIIATDRD
SSQRDLFEAIEKGDYPKWTMYIQVMTEEQAKNHKDNPFDLTKVWYHDEYPLIEVGEFELN
RNPDNYFMDVEQAAFAPTNIIPGLDFSPDKMLQGRLFSYGDAQRYRLGVNHWQIPVNQPK
GVGIENLCPFSRDGQMRVVDNNQGGGTHYYPNNHGKFDSQPEYKKPPFPTDGYGYEYNQR
QDDDNYFEQPGKLFRLQSEDAKERIFTNTANAMEGVTDDVKRRHIRHCYKADPEYGKGVA
KALGIDINSIDLETENDETYENFEK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacaagacaaaaagttaactggtgtttttgggcatccagtatcagatcgagaa
aatagtatgacagcgggacctaggggaccactattaatgcaagatatttactttttagag
caaatgtctcaatttgatagagaagtaataccagaacgtcgaatgcatgccaaaggttct
ggtgcatttgggacatttactgtaactaaagatataacaaaatatacgaatgctaaaata
ttctctgaaataggtaagcaaaccgaaatgtttgcccgtttttctactgtagcaggagaa
cgtggtgctgctgatgcggagcgtgacattcgaggatttgcgttaaagttctacactgaa
gaaggaaactgggatttagtagggaataacacaccagtattcttctttagagatccaaag
ttatttgttagtttaaatcgtgcggtgaaacgagatcctagaacaaatatgagagatgca
caaaataactgggatttctggacggggcttccagaagcattgcaccaagtaacgatctta
atgtcagatagagggattcctaaagatttacgtcatatgcatgggttcggttcacacaca
tactctatgtataatgattctggtgaacgtgtttgggttaaattccattttagaacgcaa
caaggtattgaaaacttaactgatgaagaagctgctgaaattatagctacagatcgcgat
tcatctcaacgcgatttattcgaagccattgaaaaaggtgattatccaaaatggacaatg
tatattcaagtaatgactgaggaacaagctaaaaaccataaagataatccatttgattta
acaaaagtatggtatcacgatgagtatcctctaattgaagttggagagtttgaattaaat
agaaatccagataattactttatggatgttgaacaagctgcttttgcaccaactaatatt
attccaggattggatttttctccagacaaaatgctgcaagggcgtttattctcatatggc
gatgcgcaaagatatcgattaggagttaatcattggcagattcctgtaaaccaacctaaa
ggtgttggtattgaaaatctttgtccttttagtagagatggtcaaatgcgtgtagttgac
aataaccaaggtggaggaacacattattatccaaataaccatggtaaatttgattctcaa
cctgaatataaaaagccaccattcccaactgatggatacggctatgaatataatcaacgt
caagatgatgataattattttgaacaaccaggtaaattgtttagattacaatcagaggac
gctaaagaaagaattttcacaaatacagcaaatgcaatggaaggcgtaacggatgatgtt
aaacgacgtcatattcgtcattgttacaaagctgacccagaatatggtaaaggtgttgca
aaagcattaggtattgatataaattctattgatcttgaaactgaaaatgatgaaacatac
gaaaactttgaaaaataa

DBGET integrated database retrieval system