KEGG   Staphylococcus aureus CA-347: CA347_2198Help
Entry
CA347_2198        CDS       T02702                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sauc  Staphylococcus aureus CA-347
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CA347_2198 (tdk)
Enzymes [BR:sauc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CA347_2198 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2227083..2227682)
Genome map
AA seq 199 aa AA seqDB search
MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
NAIEAINISKASEIMTHDLTNVDVIGIDEVQFFDDEIVNIVEKLSSGGHRVIVAGLDMDF
RGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYE
PRCRAHHIVAPSDNNKEEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaacttaccattccggttggatagaatgtattacaggtagtatgtttagcggt
aaatccgaagaactaataagacgtctaagaaggggtatatacgctaaacaaaaagtcgtt
gtatttaaaccggcgattgatgatcgatatcataaagaaaaagtggtctctcataatggt
aatgccattgaagcgattaatatttctaaagcaagtgaaattatgacgcacgacttaact
aatgttgatgtaataggaatagacgaagtgcaattttttgacgatgaaattgtaaatata
gtagaaaaactatcatcgggtggacaccgtgttattgttgctggattagatatggatttt
aggggcgaaccgttcgaaccgatgcctaaattgatggctgtcagtgaacaagtaacgaaa
cttcaagcagtttgtgccgtttgtggttcttcatctagtagaacgcaacgattaataaat
ggtaaaccagctaaaattgatgatccgattatcttagtaggtgccaatgaaagttatgaa
ccacgttgtcgcgcgcaccatatcgtagcacctagtgataataataaggaggaattataa

DBGET integrated database retrieval system