KEGG   Staphylococcus aureus CA-347: CA347_799Help
Entry
CA347_799         CDS       T02702                                 

Gene name
est
Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sauc  Staphylococcus aureus CA-347
Brite
Enzymes [BR:sauc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     CA347_799 (est)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
851748..852488
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LQSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
KTEGAIYEGFLEYARNFKKYEGKDQETIDKEMHHFKPTETLKELSEALDTIKDQVDEVFD
PILVIQAENDNMIDPQSANYIYEHVDSDEKDIKWYSQSGHVITIDKEKEQVFDDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaagttaccaaagcctttcttttttgaggaaggtaaacgtgccgtgttatta
ctacatggttttacaggcaattcgtctgatgttcgtcaattaggtcgatttttacaaaag
aaaggttatacatcgtatgcaccacaatatgaaggtcatgcagcaccaccagaagagata
cttcaatcaagtccttttgtttggtttaaagatgccttagatggctatgactaccttgtt
gaacaaggttatgatgaaatcgttgttgctggcttgtcattaggtggcgattttgcatta
aaattaagcttaaatcgagatgtaaagggtattgtaacgatgtgtgctcctatgggtggc
aaaactgaaggtgccatttatgaaggctttttagaatatgcacgcaattttaaaaagtat
gagggtaaagatcaagaaacgattgacaaagaaatgcatcatttcaaaccaactgaaact
ttaaaagaattaagtgaagcattagatacgattaaagatcaagttgatgaggtgtttgac
ccaattttagtgattcaagcagaaaacgacaatatgattgatccacaatccgcaaattat
atatatgaacatgtagactctgacgaaaaagatatcaaatggtatagtcagtcaggacat
gttattacaattgataaagaaaaagaacaagttttcgatgatatttatcaatttttagag
tcattagactggtcagaataa

DBGET integrated database retrieval system