KEGG   Staphylococcus aureus CA-347: CA347_879Help
Entry
CA347_879         CDS       T02702                                 

Gene name
gluD
Definition
NAD-specific glutamate dehydrogenase
Orthology
K00260  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
sauc  Staphylococcus aureus CA-347
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    CA347_879 (gluD)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CA347_879 (gluD)
   00330 Arginine and proline metabolism
    CA347_879 (gluD)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CA347_879 (gluD)
Enzymes [BR:sauc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     CA347_879 (gluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
926163..927407
Genome map
AA seq 414 aa AA seqDB search
MTENNNLVTSTQGIIKEALHKLGFDEGMYDLIKEPLRMLQVRIPVRMDDGTVKTFTGYRA
QHNDAVGPTKGGVRFHPDVDEEEVKALSMWMTLKCGIVNLPYGGGKGGIVCDPRQMSIHE
VERLSRGYVRAISQFVGPNKDIPAPDVFTNSQIMAWMMDEYSALDKFNSPGFITGKPIVL
GGSHGRDRSTALGVVIAIEQAAKRRNMQIEGAKVVIQGFGNAGSFLAKFLYDLGAKIVGI
SDAYGALHDPNGLDIDYLLDRRDSFGTVTNLFEETISNKELFELDCDILVPAAISNQITE
DNAHDIKASIVVEAANGPTTPEATRILTERGILLVPDVLASAGGVTVSYFEWVQNNQGYY
WSEEEVNEKLREKLEAAFDTIYELSQNRKIDMRLAAYIIGIKRTAEAARYRGWA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaacaataatttagtaacttctactcaaggaattattaaagaagcattgcat
aaattgggatttgacgaaggaatgtacgatttaattaaagaacctttaagaatgttacaa
gtgcgtatccctgtacgaatggatgatggcactgttaaaacattcacaggttaccgtgcg
caacataatgatgctgttggaccaacaaaagggggcgtgcgtttccacccagatgttgat
gaagaagaagtaaaagcattatcaatgtggatgactttgaaatgtggcattgttaactta
ccatacggtggtggtaagggtggtatcgtttgtgatccacgtcaaatgagcattcatgaa
gttgaacgtttatcacgcggatatgtaagagcaatttcacaattcgtaggtccgaacaaa
gatattccagcaccagatgtatttacaaactcacaaattatggcttggatgatggatgaa
tatagtgcattagataaatttaattcaccaggtttcatcacaggtaaaccaattgtattg
ggtggttctcatggacgcgacagatcaactgcactaggtgtagttattgcaattgaacaa
gctgcaaaacgtcgtaatatgcaaattgaaggtgccaaggttgttattcaaggtttcggt
aatgccggaagtttcttagctaaattcttatatgatttaggtgcaaaaattgtaggtatc
tctgatgcttatggtgcattacacgatccaaatggcttagatatagattatttattagac
cgtcgtgatagttttggtacggtaacaaatttatttgaagaaacaatctcaaataaagaa
ttgtttgaattagattgtgacattttagtaccagcggctatttcaaaccaaattacagaa
gacaatgcacatgatattaaagctagcatcgttgttgaagctgctaatggacctacaaca
ccagaagcaacacgtattttaactgaacgtggtatattattagttccagacgtattagca
agtgctggtggtgtaacggtttcttatttcgaatgggtacaaaataatcaaggttattat
tggtctgaagaagaagttaatgaaaagctacgtgaaaaattagaagcggcatttgatacg
atttacgaattgtctcaaaatcgaaaaatagatatgagacttgcagcatatatcataggt
attaaacgtacagcagaagcagctagatatcgtggttgggcataa

DBGET integrated database retrieval system