KEGG   Staphylococcus aureus CA-347: CA347_879Help
Entry
CA347_879         CDS       T02702                                 

Gene name
gluD
Definition
(GenBank) NAD-specific glutamate dehydrogenase
  KO
K00260  glutamate dehydrogenase [EC:1.4.1.2]
Organism
sauc  Staphylococcus aureus CA-347
Pathway
sauc00220  Arginine biosynthesis
sauc00250  Alanine, aspartate and glutamate metabolism
sauc00430  Taurine and hypotaurine metabolism
sauc00910  Nitrogen metabolism
sauc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    CA347_879 (gluD)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CA347_879 (gluD)
   00220 Arginine biosynthesis
    CA347_879 (gluD)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CA347_879 (gluD)
Enzymes [BR:sauc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     CA347_879 (gluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N 2-Hacid_dh_C CobS_N
Motif
Other DBs
NCBI-ProteinID: AGO29236
Position
926163..927407
Genome map
AA seq 414 aa AA seqDB search
MTENNNLVTSTQGIIKEALHKLGFDEGMYDLIKEPLRMLQVRIPVRMDDGTVKTFTGYRA
QHNDAVGPTKGGVRFHPDVDEEEVKALSMWMTLKCGIVNLPYGGGKGGIVCDPRQMSIHE
VERLSRGYVRAISQFVGPNKDIPAPDVFTNSQIMAWMMDEYSALDKFNSPGFITGKPIVL
GGSHGRDRSTALGVVIAIEQAAKRRNMQIEGAKVVIQGFGNAGSFLAKFLYDLGAKIVGI
SDAYGALHDPNGLDIDYLLDRRDSFGTVTNLFEETISNKELFELDCDILVPAAISNQITE
DNAHDIKASIVVEAANGPTTPEATRILTERGILLVPDVLASAGGVTVSYFEWVQNNQGYY
WSEEEVNEKLREKLEAAFDTIYELSQNRKIDMRLAAYIIGIKRTAEAARYRGWA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaacaataatttagtaacttctactcaaggaattattaaagaagcattgcat
aaattgggatttgacgaaggaatgtacgatttaattaaagaacctttaagaatgttacaa
gtgcgtatccctgtacgaatggatgatggcactgttaaaacattcacaggttaccgtgcg
caacataatgatgctgttggaccaacaaaagggggcgtgcgtttccacccagatgttgat
gaagaagaagtaaaagcattatcaatgtggatgactttgaaatgtggcattgttaactta
ccatacggtggtggtaagggtggtatcgtttgtgatccacgtcaaatgagcattcatgaa
gttgaacgtttatcacgcggatatgtaagagcaatttcacaattcgtaggtccgaacaaa
gatattccagcaccagatgtatttacaaactcacaaattatggcttggatgatggatgaa
tatagtgcattagataaatttaattcaccaggtttcatcacaggtaaaccaattgtattg
ggtggttctcatggacgcgacagatcaactgcactaggtgtagttattgcaattgaacaa
gctgcaaaacgtcgtaatatgcaaattgaaggtgccaaggttgttattcaaggtttcggt
aatgccggaagtttcttagctaaattcttatatgatttaggtgcaaaaattgtaggtatc
tctgatgcttatggtgcattacacgatccaaatggcttagatatagattatttattagac
cgtcgtgatagttttggtacggtaacaaatttatttgaagaaacaatctcaaataaagaa
ttgtttgaattagattgtgacattttagtaccagcggctatttcaaaccaaattacagaa
gacaatgcacatgatattaaagctagcatcgttgttgaagctgctaatggacctacaaca
ccagaagcaacacgtattttaactgaacgtggtatattattagttccagacgtattagca
agtgctggtggtgtaacggtttcttatttcgaatgggtacaaaataatcaaggttattat
tggtctgaagaagaagttaatgaaaagctacgtgaaaaattagaagcggcatttgatacg
atttacgaattgtctcaaaatcgaaaaatagatatgagacttgcagcatatatcataggt
attaaacgtacagcagaagcagctagatatcgtggttgggcataa

DBGET integrated database retrieval system