KEGG   Staphylococcus aureus CA-347: CA347_879Help
Entry
CA347_879         CDS       T02702                                 

Gene name
gluD
Definition
NAD-specific glutamate dehydrogenase
Orthology
K00260  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
sauc  Staphylococcus aureus CA-347
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:sauc00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sauc00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sauc00330]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:sauc00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
926163..927407
Genome map
AA seq 414 aa AA seqDB search
MTENNNLVTSTQGIIKEALHKLGFDEGMYDLIKEPLRMLQVRIPVRMDDGTVKTFTGYRA
QHNDAVGPTKGGVRFHPDVDEEEVKALSMWMTLKCGIVNLPYGGGKGGIVCDPRQMSIHE
VERLSRGYVRAISQFVGPNKDIPAPDVFTNSQIMAWMMDEYSALDKFNSPGFITGKPIVL
GGSHGRDRSTALGVVIAIEQAAKRRNMQIEGAKVVIQGFGNAGSFLAKFLYDLGAKIVGI
SDAYGALHDPNGLDIDYLLDRRDSFGTVTNLFEETISNKELFELDCDILVPAAISNQITE
DNAHDIKASIVVEAANGPTTPEATRILTERGILLVPDVLASAGGVTVSYFEWVQNNQGYY
WSEEEVNEKLREKLEAAFDTIYELSQNRKIDMRLAAYIIGIKRTAEAARYRGWA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaacaataatttagtaacttctactcaaggaattattaaagaagcattgcat
aaattgggatttgacgaaggaatgtacgatttaattaaagaacctttaagaatgttacaa
gtgcgtatccctgtacgaatggatgatggcactgttaaaacattcacaggttaccgtgcg
caacataatgatgctgttggaccaacaaaagggggcgtgcgtttccacccagatgttgat
gaagaagaagtaaaagcattatcaatgtggatgactttgaaatgtggcattgttaactta
ccatacggtggtggtaagggtggtatcgtttgtgatccacgtcaaatgagcattcatgaa
gttgaacgtttatcacgcggatatgtaagagcaatttcacaattcgtaggtccgaacaaa
gatattccagcaccagatgtatttacaaactcacaaattatggcttggatgatggatgaa
tatagtgcattagataaatttaattcaccaggtttcatcacaggtaaaccaattgtattg
ggtggttctcatggacgcgacagatcaactgcactaggtgtagttattgcaattgaacaa
gctgcaaaacgtcgtaatatgcaaattgaaggtgccaaggttgttattcaaggtttcggt
aatgccggaagtttcttagctaaattcttatatgatttaggtgcaaaaattgtaggtatc
tctgatgcttatggtgcattacacgatccaaatggcttagatatagattatttattagac
cgtcgtgatagttttggtacggtaacaaatttatttgaagaaacaatctcaaataaagaa
ttgtttgaattagattgtgacattttagtaccagcggctatttcaaaccaaattacagaa
gacaatgcacatgatattaaagctagcatcgttgttgaagctgctaatggacctacaaca
ccagaagcaacacgtattttaactgaacgtggtatattattagttccagacgtattagca
agtgctggtggtgtaacggtttcttatttcgaatgggtacaaaataatcaaggttattat
tggtctgaagaagaagttaatgaaaagctacgtgaaaaattagaagcggcatttgatacg
atttacgaattgtctcaaaatcgaaaaatagatatgagacttgcagcatatatcataggt
attaaacgtacagcagaagcagctagatatcgtggttgggcataa

DBGET integrated database retrieval system