KEGG   Staphylococcus aureus subsp. aureus 6850 (MSSA): RSAU_000102Help
Entry
RSAU_000102       CDS       T02825                                 

Gene name
adhE
Definition
(GenBank) alcohol dehydrogenase, iron-containing
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
saue  Staphylococcus aureus subsp. aureus 6850 (MSSA)
Pathway
saue00010  Glycolysis / Gluconeogenesis
saue00071  Fatty acid degradation
saue00350  Tyrosine metabolism
saue00620  Pyruvate metabolism
saue00625  Chloroalkane and chloroalkene degradation
saue00626  Naphthalene degradation
saue00650  Butanoate metabolism
saue01100  Metabolic pathways
saue01110  Biosynthesis of secondary metabolites
saue01120  Microbial metabolism in diverse environments
saue01130  Biosynthesis of antibiotics
saue01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:saue00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSAU_000102 (adhE)
   00620 Pyruvate metabolism
    RSAU_000102 (adhE)
   00650 Butanoate metabolism
    RSAU_000102 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    RSAU_000102 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RSAU_000102 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSAU_000102 (adhE)
   00626 Naphthalene degradation
    RSAU_000102 (adhE)
Enzymes [BR:saue01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RSAU_000102 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RSAU_000102 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AGU53976
Position
112799..115408
Genome map
AA seq 869 aa AA seqDB search
MLTIPEKENRGSKEQEVAIMIDALADKGKKALEALSKKSQEEIDHIVHQMSLAAVDQHMV
LAKLAHEETGRGIYEDKAIKNLYASEYIWNSIKDNKTVGIIGEDKEKGLTYVAEPIGVIC
GVTPTTNPTSTTIFKAMIAIKTGNPIIFAFHPSAQESSKRAAEVVLEAAMKAGAPKDIIQ
WIEVPSIEATKQLMNHKGIALVLATGGSGMVKSAYSTGKPALGVGPGNVPSYIEKTAHIK
RAVNDIIGSKTFDNGMICASEQVVVIDKEIYKDVTNEFKAHQAYFVKKDELQRLENAIMN
EQKTGIKPDIVGKSAVEIAELAGIPVPENTKLIIAEISGVGSDYPLSREKLSPVLALVKA
QSTKQAFQICEDTLHFGGLGHTAVIHTEDETLQKDFGLRMKACRVLVNTPSAVGGIGDMY
NELIPSLTLGCGSYGRNSISHNVSATDLLNIKTIAKRRNNTQIFKVPAQIYFEENAIMSL
TTMDKIEKVMIVCDPGMVEFGYTKTVENVLRQRTEQPQIKIFNEVEPNPSTNTVYKGLEM
MVDFQPDTIIALGGGSAMDAAKAMWMFFEHPETSFFGAKQKFLDIGKRTYKIGMPENATF
ICIPTTSGTGSEVTPFAVITDSETNVKYPLADFALTPDVAIIDPQFVMSVPKSVTADTGM
DVLTHAMESYVSVMASDYTRGLSLQAIKLTFEYLKSSVEKGDKVSREKMHNASTLAGMAF
ANAFLGIAHSIAHKIGGEYGIPHGRANAILLPHIIRYNAKDPQKHALFPKYEFFRADTDY
ADIAKFLGLKGNTTEALVESLAKAVYELGQSVGIEMNLKSQGVSEEELNESIDRMAELAF
EDQCTTANPKEALISEIKDIIQTSYDYKQ
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgttaactatacctgaaaaagaaaatcgtggatcgaaagaacaagaagtggcaattatg
attgatgctctagctgacaaagggaaaaaagcattagaagcattatctaaaaagtcacaa
gaagaaattgatcatattgttcatcaaatgagcttagcagctgttgatcaacatatggtg
ctagcaaaattagcacatgaagaaactggaagaggtatatacgaagataaagcgattaaa
aatttatacgcttctgaatatatatggaattcaataaaagacaataaaacagtagggatt
attggtgaagataaagaaaaaggattaacgtatgtagcggaaccaattggtgttatttgt
ggtgttacgccaacaacaaatcctacgtcgacaactatttttaaagcgatgattgcaatt
aagacaggaaatccaatcatttttgcattccatccaagtgcgcaagaatcgtcgaagcgt
gcagcagaagttgtattagaagcggcaatgaaggcaggtgcacctaaagatattattcaa
tggattgaagtgccttctatcgaagcaacaaaacaattaatgaatcacaaaggtattgca
ttagttctagcaacaggtggttcgggcatggttaagtctgcatattcaactggtaaaccg
gcattaggtgtgggaccaggtaacgtgccgtcttacattgaaaaaacagcacacattaag
cgtgcagtaaatgatatcattggttcaaaaacatttgataatggtatgatttgtgcttct
gaacaagttgtagtcattgacaaagaaatttataaagacgttactaatgaatttaaagca
catcaagcatattttgttaaaaaagatgaattacaacgcttagaaaatgcaattatgaat
gaacaaaaaacaggtattaagcctgatattgtcggtaaatctgcagttgaaatagctgaa
ttagcaggtatacctgtccccgaaaatacaaaacttatcatagctgaaattagcggtgta
ggttcagactatccgttatctcgtgaaaaattatctccagtattagccttagtaaaagcc
caatctacaaaacaagcatttcaaatttgtgaagacacactacattttggtggattagga
cacacagccgttatccatacagaagatgaaacattacaaaaagattttggactaagaatg
aaagcttgtcgtgtacttgtaaatacaccatcagcagttggaggtattggtgatatgtat
aacgaattgattccgtctttaacattaggttgtggttcgtacggtagaaactcaatttca
cataatgttagtgcgacagatttattaaacattaaaacgattgctaaacgacgtaataat
actcaaattttcaaggtgcctgctcaaatttattttgaagaaaatgcaatcatgagtcta
acaacaatggacaagattgaaaaagtgatgattgtctgtgaccctggtatggtcgaattc
ggttatacaaaaacagttgagaatgtattaagacaaagaacggaacagcctcaaattaaa
atatttaacgaagtcgaaccgaacccatcaactaatacagtatataaaggtctggaaatg
atggttgatttccaaccggatacaatcattgcacttggtggtggttcagcgatggatgct
gcaaaagcaatgtggatgttctttgaacaccctgagacatcattcttcggtgctaaacaa
aagttcctagacatcggtaaacgtacttataaaataggcatgcctgaaaatgcgacgttc
atttgtatccctacgacatcaggtacaggttcagaagtaacaccatttgcagttatcaca
gatagtgaaacaaatgtaaaatatccgttggctgattttgctttaacacctgacgttgca
attattgaccctcaatttgtgatgagtgtgccaaaaagcgttacagcagatacaggaatg
gatgtactaacgcatgcaatggaatcatatgtatctgtaatggcttcagattacacaaga
ggtttgagtctacaagcgattaaattgacgttcgaatatttaaaatcatctgttgaaaaa
ggtgataaagtttcaagagagaaaatgcataacgcatcaactttggctggtatggcattt
gcaaatgcattcttaggcattgcacactcaattgcgcataaaattggtggggaatatggt
attccgcatggtagagcgaatgcgatattactaccgcatattatccgttataatgctaaa
gacccgcaaaaacatgcattattccctaaatatgagttcttcagagcagatacagattat
gcagatattgccaaattcttaggattaaaaggtaatacgacagaagcactcgtagaatca
ttagctaaagctgtctatgaattaggtcaatcagtcggaattgaaatgaatttgaaatca
caaggtgtgtctgaagaagaattaaatgagtcaattgatagaatggcagagctcgcattt
gaagatcagtgtacaactgctaatcctaaagaagcactaatcagtgaaatcaaagatatc
attcaaacatcatatgattataagcaataa

DBGET integrated database retrieval system