KEGG   Staphylococcus aureus subsp. aureus 6850 (MSSA): RSAU_000390Help
Entry
RSAU_000390       CDS       T02825                                 

Definition
carboxylesterase, putative
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
saue  Staphylococcus aureus subsp. aureus 6850 (MSSA)
Brite
Enzymes [BR:saue01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     RSAU_000390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
431642..432376
Genome map
AA seq 244 aa AA seqDB search
MRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNDQGFSCYAPNYPGHGLLLKD
FMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLAQHYPLKRIAVMSAPKE
KSDNGLIEHLVYYSQRMSNILNLDQQASSAQLAAIDDYEGEITKFQHFIDDIMTNLNVIK
MPANILFGGKDAPSYETSAHFIYEHLGSVDKELNGLKDSHHLMTHGEGRDILEENVIRFF
NALT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagaattaaaacaccgagtccatcttatttaaaaggcacaaatggacatgcgatatta
ttattacattcatttacaggtacaaatcgggatgtgaagcatcttgcagctgagttaaat
gaccaaggatttagttgttatgcaccgaattatccaggtcatggtttattgttgaaagat
ttcatgacatataatgtagatgattggtgggaagaagttgagaaagcttaccaattttta
gtcaatgaaggttatgaatctatcagtgcaacgggtgtgtctttaggtggattaatgaca
ttaaaattggcgcagcactacccgttgaaacgtatcgctgtcatgtcagcaccaaaggaa
aagagtgataatggcttaatagaacatttagtttattatagtcaacgcatgtcgaatatt
ttaaatttagatcagcaagcatcgagtgcgcaattagcagcaattgatgattatgaaggt
gaaattacgaagtttcaacattttattgatgatatcatgacaaatttaaatgttattaaa
atgccagctaatatattatttggtggtaaagatgcgccatcctatgaaacaagtgcacac
tttatttatgaacatttaggatcagtagacaaagaattaaatggtctgaaggattcacat
catttaatgacgcatggagaaggcagagatattttagaagaaaatgttattcgctttttc
aatgctttaacataa

DBGET integrated database retrieval system