KEGG   Staphylococcus aureus subsp. aureus 6850 (MSSA): RSAU_000529Help
Entry
RSAU_000529       CDS       T02825                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA acetyltransferase, putative
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saue  Staphylococcus aureus subsp. aureus 6850 (MSSA)
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:saue00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSAU_000529 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    RSAU_000529 (vraB)
   00640 Propanoate metabolism
    RSAU_000529 (vraB)
   00650 Butanoate metabolism
    RSAU_000529 (vraB)
  Lipid metabolism
   00071 Fatty acid degradation
    RSAU_000529 (vraB)
   00072 Synthesis and degradation of ketone bodies
    RSAU_000529 (vraB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSAU_000529 (vraB)
   00310 Lysine degradation
    RSAU_000529 (vraB)
   00380 Tryptophan metabolism
    RSAU_000529 (vraB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RSAU_000529 (vraB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RSAU_000529 (vraB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSAU_000529 (vraB)
Enzymes [BR:saue01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RSAU_000529 (vraB)
Exosome [BR:saue04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSAU_000529 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
583287..584426
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMRDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIVEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNMQLNIWGGALASGHPYGASGAQLVTRLFYMYDRETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggaggcact
ttaaaacatttagagccagaacaattgctcaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcagggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatt
caagccggagctggcaaggtatatattgcaggcggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagagacccatcaatgattcaaggtgctgaaaatgtagcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaattg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattgtggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtggttgcctgccaacaagcttta
aatatttcaaatatgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgacgcgattattttatatgtatgacagagagactatg
attgcatctatggggattgggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system