KEGG   Staphylococcus aureus subsp. aureus 6850: RSAU_000757Help
Entry
RSAU_000757       CDS       T02825                                 

Gene name
est
Definition
carboxylesterase precursor, putative
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
saue  Staphylococcus aureus subsp. aureus 6850
Brite
Enzymes [BR:saue01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     RSAU_000757 (est)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
820059..820799
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LQSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
KTEGAIYEGFLEYARNFKKYEGKDQETIDNEMHHFKPTETLKELSEALDTIKDQVDEVFD
PILVIQAENDNMIDPQSANYIYEHVDSDEKDIKWYSQSGHVITIDKEKEQVFDDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaagttaccaaagcctttcttttttgaggaaggtaaacgtgccgtgttatta
ctacatggttttacaggcaattcgtccgatgttcgtcaattaggtcgatttttacaaaag
aaaggttatacatcgtatgcaccgcaatatgaaggtcatgcagcaccaccagaagagata
cttcaatcaagcccttttgtttggtttaaagatgccttagatggctatgactaccttgtt
gaacaaggttatgatgaaatcgttgttgctggcttgtcattaggtggcgattttgcatta
aaattaagcttaaatcgagatgtaaagggtattgtaacgatgtgtgctcctatgggtggc
aaaactgaaggtgccatttatgaaggctttttagaatatgcacgcaattttaaaaagtat
gagggtaaagatcaagaaacgattgataacgaaatgcatcatttcaaaccaactgaaact
ttaaaagaattaagtgaagcattagatacgattaaagatcaagttgatgaggtttttgac
ccaattttagtgattcaagcagaaaacgacaatatgattgatccacaatccgcaaattat
atatatgaacatgtagactctgacgaaaaagatatcaaatggtatagtcagtcaggacat
gttattacaattgataaagaaaaagaacaagttttcgatgatatttatcaatttttagag
tcattagactggtcagaataa

DBGET integrated database retrieval system