KEGG   Staphylococcus aureus subsp. aureus ST228/10497 (MRSA): SAI2T2_1004470Help
Entry
SAI2T2_1004470    CDS       T03144                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sauj  Staphylococcus aureus subsp. aureus ST228/10497 (MRSA)
Pathway
sauj00071  Fatty acid degradation
sauj00072  Synthesis and degradation of ketone bodies
sauj00280  Valine, leucine and isoleucine degradation
sauj00310  Lysine degradation
sauj00362  Benzoate degradation
sauj00380  Tryptophan metabolism
sauj00620  Pyruvate metabolism
sauj00630  Glyoxylate and dicarboxylate metabolism
sauj00640  Propanoate metabolism
sauj00650  Butanoate metabolism
sauj00900  Terpenoid backbone biosynthesis
sauj01100  Metabolic pathways
sauj01110  Biosynthesis of secondary metabolites
sauj01120  Microbial metabolism in diverse environments
sauj01130  Biosynthesis of antibiotics
sauj01200  Carbon metabolism
sauj01212  Fatty acid metabolism
sauj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sauj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAI2T2_1004470
   00630 Glyoxylate and dicarboxylate metabolism
    SAI2T2_1004470
   00640 Propanoate metabolism
    SAI2T2_1004470
   00650 Butanoate metabolism
    SAI2T2_1004470
  Lipid metabolism
   00071 Fatty acid degradation
    SAI2T2_1004470
   00072 Synthesis and degradation of ketone bodies
    SAI2T2_1004470
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI2T2_1004470
   00310 Lysine degradation
    SAI2T2_1004470
   00380 Tryptophan metabolism
    SAI2T2_1004470
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAI2T2_1004470
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAI2T2_1004470
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAI2T2_1004470
Enzymes [BR:sauj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAI2T2_1004470
Exosome [BR:sauj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAI2T2_1004470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCJ12376
Position
606311..607450
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaatactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system