KEGG   Staphylococcus aureus M1: BN843_16890Help
Entry
BN843_16890       CDS       T02618                                 

Definition
Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
saum  Staphylococcus aureus M1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:saum03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1780113..1780985)
Genome map
AA seq 290 aa AA seqDB search
MPELPEVEHVKRGIEPYVINQKIEHVIFSDKVIEGKAQGKETIIKGIELDTFKTLSEGYT
ITNVERRSKYIVFQLDNKREQRTLISHLGMAGGFFIVDELEDIMIPNYRKHWHVIFELSN
DKKLIYSDIRRFGEIRNVASVASYPSFLEIAPEPFSNEALTYYLNRIHQQSNKNKPIKQV
ILDHKVIAGCGNIYACEALFRAGVLPDKKVKDLTHQQQEMVFYYVREVLEEGIKYGGTSI
SDYRHADGKTGEMQLHLNVYKQPVCKVCGSQIETKIIATRNSHYCPVCQK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaattaccagaagtagaacatgtaaaaagaggaattgaaccctacgttataaat
caaaaaattgaacacgttatattttcggataaagtaatcgaaggtaaagctcaaggcaag
gaaacaattataaaaggaattgaattagatacttttaaaactttatcggaaggctatacc
attacaaatgtagaacgaagaagtaaatatatcgtttttcagctagataataaacgagaa
caacgtacattaattagtcatttaggtatggcgggcggttttttcattgtagatgaactt
gaagatattatgatacctaattatcgtaagcattggcatgttatttttgagttgtcaaat
gacaaaaagttaatttattcagatatacgtcgttttggagaaattagaaatgttgcgtct
gtagcatcttatccttcatttttagaaatagcgcctgaacctttttcaaatgaagcattg
acgtattatttaaatcgaattcatcaacagtctaataagaataaaccaatcaaacaagtg
attttggatcataaagtaatcgcaggttgtggaaatatttacgcatgtgaagcgttgttt
cgtgcaggtgttttaccagataaaaaagtaaaagacttaacacaccaacaacaagaaatg
gttttttattatgttagagaagtactagaagaaggtattaaatatggcggtacaagtatt
tcagattatcgtcatgctgatggaaaaactggtgagatgcaattgcatcttaatgtatat
aagcagccggtatgcaaagtgtgtggaagtcaaattgaaacaaaaatcatcgcgacaaga
aatagtcattattgtccagtatgtcaaaaataa

DBGET integrated database retrieval system