KEGG   Staphylococcus aureus M1: BN843_27160Help
Entry
BN843_27160       CDS       T02618                                 

Definition
Histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
saum  Staphylococcus aureus M1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saum00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN843_27160
  Amino acid metabolism
   00340 Histidine metabolism
    BN843_27160
Enzymes [BR:saum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BN843_27160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2826320..2827570)
Genome map
AA seq 416 aa AA seqDB search
MLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEISHE
QIKAAFDTLDEKTKQALQQSYERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYVPG
GKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVLAACYITQVDQVFQVGGAQSI
AALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDETADLDAIV
YDVFAQAEHDELARTYAISEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHASN
FDEACHVMNTIAPEHASIQTVNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLPTN
RTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAHVEALYNHQQSILIRQS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgcacaacaatttttaaatcaattttcattagaagcaccattagatgagtca
ttgtatccaattattcgcgatatttgtcaggaagttaaagttcatggagataaggctttg
aaaatgtataatctaacattcgatcatacgaaaacagatcatttagaaattagtcatgaa
caaattaaagcagcatttgacacattagatgaaaaaacaaaacaagcattacaacaaagt
tatgaaagaattaaagcatatcaagaaagtattaaacagacgaatcaacagttagaagaa
tcagtggagtgttatgaaatataccatccactagaaagtgtcggtatttatgtgcctggt
ggtaaagcaagttatccttcaacggtattaatgacagcgacgttagcacaagtagcaggt
gtggaaaatattgtcgttgtgacaccacctcaacctaatggtgtgtctcaagaagtatta
gcagcatgctatattacgcaagttgatcaagtatttcaagttggtggtgctcaaagtatt
gctgcgttaacttatggcacagaaacgatacctaaagttgataagattgtaggtccaggc
aatcaatttgttgcatatgccaagaaatatttatttggacaagtaggtattgaccaaata
gctggaccaacagaaatagcacttattattgatgaaacagcagatttagatgccatcgta
tatgatgtttttgcacaagcagaacatgatgaattagcacgtacatatgccattagtgaa
gatgcgcaagtccttaaagatttagaatcacgtattgctaaagcattgcctaatgtggac
agatacgacattgtttctaaaagtatcgctaatcaacactaccttatccatgctagtaat
tttgatgaagcatgccatgtcatgaatacaatcgcgcctgaacatgcgtcgattcaaaca
gtaaatcctcaaccatatattgaaaaagtgaaatatgtgggtgcattgtttattggacat
tattcgccagaggtcataggagattacgttgcaggtccaagtcatgtattacctacaaat
agaacagctagatttaccaatgggttatcggtcaatgatttcttaacacggaacacggtc
atccatttatcaaaagatacgtttgaacaaattgctgattcagcacaacatattgctcat
gttgaagcattatacaatcaccagcagtctattttaatacgtcagtcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system