KEGG   Staphylococcus aureus subsp. aureus CN1 (CA-MRSA): SAKOR_00128Help
Entry
SAKOR_00128       CDS       T02826                                 

Definition
Acetaldehyde dehydrogenase [acetylating] (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
saun  Staphylococcus aureus subsp. aureus CN1 (CA-MRSA)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:saun00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAKOR_00128
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAKOR_00128
   00620 Pyruvate metabolism
    SAKOR_00128
   00650 Butanoate metabolism
    SAKOR_00128
  Lipid metabolism
   00071 Fatty acid degradation
    SAKOR_00128
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAKOR_00128
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAKOR_00128
   00626 Naphthalene degradation
    SAKOR_00128
Enzymes [BR:saun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAKOR_00128
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SAKOR_00128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
132514..135129
Genome map
AA seq 871 aa AA seqDB search
MYMLTIPEKENRGSKEQEVAIMIDALADKGKKALEALSKKSQEEIDHIVHQMSLAAVDQH
MVLAKLAHEETGRGIYEDKAIKNLYASEYIWNSIKDNKTVGIIGEDKEKGLTYVAEPIGV
ICGVTPTTNPTSTTIFKAMIAIKTGNPIIFAFHPSAQESSKRAAEVVLEAAMKAGAPKDI
IQWIEVPSIEATKQLMNHKGIALVLATGGSGMVKSAYSTGKPALGVGPGNVPSYIEKTAH
IKRAVNDIIGSKTFDNGMICASEQVVVIDKEIYKDVTNEFKAHQAYFVKKDELQRLENAI
MNEQKTGIKPDIVGKSAVEIAELAGIPVPENTKLIIAEISGVGSDYPLSREKLSPVLALV
KAQSTKQALQICEDTLHFGGLGHTAVIHTEDETLQKDFGLRMKACRVLVNTPSAVGGIGD
MYNELIPSLTLGCGSYGRNSISHNVSATDLLNIKTIAKRRNNTQIFKVPAQIYFEENAIM
SLTTMDKIEKVMIVCDPGMVEFGYTKTVENVLRQRTEQPQIKIFSEVEPNPSTNTVYKGL
EMMVDFQPDTIIALGGGSAMDAAKAMWMFFEHPETSFFGAKQKFLDIGKRTYKIGMPENA
TFICIPTTSGTGSEVTPFAVITDSETNVKYPLADFALTPDVAIIDPQFVMSVPKSVTADT
GMDVLTHAMESYVSVMASDYTRGLSLQAIKLTFEYLKSSVEKGDKVSREKMHNASTLAGM
AFANAFLGIAHSIAHKIGGEYGIPHGRANAILLPHIIRYNAKDPQKHALFPKYEFFRADT
DYADIAKFLGLKGNTTEALVESLAKAVYELGQSVGIEMNLKSQGVSEEELNESIDRMAEL
AFEDQCTTANPKEALISEIKDIIQTSYDYKQ
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
ttgtatatgttaactatacctgaaaaagaaaatcgtggatcgaaagaacaagaagtggca
attatgattgatgctctagctgacaaagggaaaaaagcattagaagcattatctaaaaag
tcacaagaagaaattgatcatattgttcatcaaatgagcttagcagctgttgatcaacat
atggtgctagcaaaattagcacatgaagaaactggaagaggtatatacgaagataaagcg
attaaaaatttatacgcttctgaatatatatggaattcaataaaagacaataagacagta
gggattattggtgaagataaagaaaaaggattaacgtatgtagcggaaccaattggtgtt
atttgtggtgttacgccaacaacaaatcctacgtcgacaactatttttaaagcgatgatt
gcaattaagacaggaaatccaatcatttttgcattccatccaagtgcacaagaatcgtcg
aagcgtgcagcagaagttgtattagaagcggcaatgaaggcaggtgcacctaaagatatt
attcaatggattgaagtgccttctatcgaagcaacaaaacaattaatgaatcacaaaggt
attgcattagttctagcaacaggtggttcgggcatggttaagtctgcatattcaactggc
aaaccggcattaggtgtgggaccaggtaacgtgccgtcttacattgaaaaaacagcacac
attaaacgtgcagtaaatgatatcattggttcaaaaacatttgataatggtatgatttgt
gcttctgaacaagttgtagtcattgataaagaaatttataaagatgttactaatgaattt
aaagcacatcaagcatattttgttaaaaaagatgaattacaacgcttagaaaatgcaatt
atgaatgaacaaaaaacaggtattaagcctgatattgtcggtaaatctgcagttgaaata
gctgaattagcaggtatacctgtccccgaaaatacaaaacttatcatagccgaaattagc
ggtgtaggttcagactatccgttatctcgtgaaaaattatctccagtattagccttagta
aaagcccaatctacaaaacaagcacttcaaatttgtgaagacacactacattttggtgga
ttaggacacacagccgttatccatacagaagatgaaacattacaaaaagattttggacta
agaatgaaagcttgtcgtgtacttgtaaatacaccatcagcggttggaggtattggtgat
atgtataacgaattgattccgtctttaacattaggttgtggttcgtacggtagaaactca
atttcacataatgttagtgcgacagatttattaaacattaaaacgattgctaaacgacgt
aataatactcaaattttcaaggtgcctgctcaaatttattttgaagaaaatgcaatcatg
agtctaacaacaatggacaagattgaaaaagtgatgattgtctgtgaccctggtatggtc
gaattcggttatacaaaaacagttgagaatgtattaagacaaagaacggaacagcctcaa
attaaaatatttagcgaagtcgaaccgaatccatcaactaatacagtatataaaggtctg
gaaatgatggttgatttccaaccggatacaatcattgcacttggtggtggttcagcgatg
gatgctgcaaaagcaatgtggatgttctttgaacaccctgagacatcattcttcggtgct
aaacaaaagttcctagacatcggtaaacgtacttataaaataggcatgcctgaaaatgcg
acgttcatttgtatccctacgacatcaggtacaggttcagaagtaacaccatttgcagtt
atcacagatagtgaaacaaatgtaaaatatccgttggctgattttgctttaacacctgat
gttgcaattattgaccctcaatttgtgatgagtgtgccaaaaagcgttacagcagataca
ggaatggatgtactaacgcatgcaatggaatcatatgtatctgtaatggcttcagactac
acaagaggtttgagtctacaagcgattaaattgacgttcgaatatttaaaatcatctgtt
gaaaagggtgataaagtttcaagagagaaaatgcataacgcatcaactttggctggtatg
gcatttgcaaatgcattcttaggtattgcacactcaattgcacataaaattggtggcgaa
tatggtattccgcatggtagagcgaatgcgatattactaccgcatattatccgttataat
gccaaagacccgcaaaaacatgcattattccctaaatatgagttcttcagagcagataca
gattatgcagatattgccaaattcttaggattaaaaggtaatacgacagaagcactcgta
gaatcattagctaaagctgtctacgaattaggtcaatcagtcggaattgaaatgaatttg
aaatcacaaggtgtgtctgaagaagaattaaatgagtcaattgatagaatggcagagctc
gcatttgaagatcaatgtacaactgctaatcctaaagaagcactaattagtgaaatcaaa
gatatcattcaaacatcatatgattataagcaataa

DBGET integrated database retrieval system