KEGG   Staphylococcus aureus subsp. aureus CN1 (CA-MRSA): SAKOR_00440Help
Entry
SAKOR_00440       CDS       T02826                                 

Definition
Carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
saun  Staphylococcus aureus subsp. aureus CN1 (CA-MRSA)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
453797..454549
Genome map
AA seq 250 aa AA seqDB search
MEVYRKMRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNAHGFSCYAPNYPGH
GLLLKDFMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLAQHYPLKRIAV
MSAPKEKSDDGLIEHLVYYSQRMSDILNLDQQASSAQLAAIDDYEGEITKFQHFIDDIMT
NLNVIKMPANILFGGKDAPSYETSAHFIYEHLGSVDKELNGLKDSHHLMTHGEGRDILEE
NVIRFFNALT
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtggaggtatatagaaaaatgagaattaaaacaccgagtccatcttatttaaaaggcaca
aatggacatgcaatattattattacattcatttacaggtacaaatcgggatgtgaagcat
cttgcagctgagttaaatgcacatggattcagttgttatgcaccgaattatccaggtcat
ggtttattgttgaaagatttcatgacatataatgtagatgattggtgggaagaagttgag
aaagcttaccaatttttagtcaatgaaggttatgaatctatcagtgcaacgggtgtgtct
ttaggtggattaatgacattaaaattggcgcaacactatcctttgaaacgtatcgctgtc
atgtcagcaccaaaggaaaagagtgacgatggtttaatagaacatttagtttattatagt
caacgcatgtcggatattttaaatttagatcagcaagcatcgagtgcgcaattagcagca
attgatgattatgaaggtgaaattacgaagtttcaacattttattgatgatatcatgaca
aatttaaatgttattaaaatgccagctaatatattatttggtggtaaagatgcgccatcc
tatgaaacaagtgcacactttatttatgaacatttaggatcagtagacaaagaattaaat
ggtctgaaggattcgcatcatttaatgacgcatggagaaggcagagatattttagaagaa
aatgttattcgctttttcaatgctttaacataa

DBGET integrated database retrieval system