KEGG   Staphylococcus aureus subsp. aureus CN1 (CA-MRSA): SAKOR_01784Help
Entry
SAKOR_01784       CDS       T02826                                 

Definition
Protoporphyrinogen IX dehydrogenase [menaquinone] (EC:1.3.3.4 1.3.5.3)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
saun  Staphylococcus aureus subsp. aureus CN1 (CA-MRSA)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saun00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAKOR_01784
Enzymes [BR:saun01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SAKOR_01784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1844593..1845993)
Genome map
AA seq 466 aa AA seqDB search
MTKSVAIIGAGITGLSSAYFLKQQDPNIDVTIFEASNRPGGKIQSYRKDGYMIELGPESY
LGRKTIMTELAKDIGLEQDIVTNTTGQSYIFAKNKLYPIPGGSIMGIPTDIKPFVTTKLI
SPLGKLRAGLDLLKKPTQMQDGDISVGAFFRARLGNEVLENLIEPLMGGIYGTDIDKLSL
MSTFPNFKEKEEAFGSLIKGMKDEKNKRLKQRQLYPGAPKGQFKQFKHGLSSFIEALEQD
VIKKGVSIQYNTTVDDIITSQKQYKIVYSDQLEEVYDGVLVTTPHQVFLNWFGQDPAFDY
FKTMDSTTVATVVLAFDEKDIENTYDGTGFVIARTSDTDITACTWTSKKWPFTTPEGKVL
IRAYVGKPGDTVVDDHTDNELVSIVRRDLSQMMTFKGDPEFTIVNRLPKSMPQYHVGHIQ
QIRQIQAHIKQTYPRLRVTGASFEAVGLPDCITQGKVAAEEVIAEL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaatcagtggctattataggagcggggataacaggtttatcaagtgcatatttt
ttaaaacagcaagatcctaatattgatgtaaccatctttgaagcatcgaatcgtccgggg
ggaaagattcaatcgtatcgtaaagatggttatatgattgaactagggcctgaatcttat
ttaggtagaaaaacaatcatgacagaattagcgaaagatattggattagaacaagatatt
gttacaaatacgactggacaatcttatatttttgcgaaaaacaaattgtatcctattcca
ggtggatcaattatgggaattccgacagatatcaaaccgtttgtgacaactaaattaatt
tcaccacttggtaaattaagagcagggttagatttacttaaaaaacctactcaaatgcag
gatggtgacatttctgttggggcatttttcagagcaagattaggtaatgaggtacttgag
aatttaatagagcctttaatgggtggtatttatggtaccgatattgataaattaagtttg
atgagtacgtttcctaattttaaagaaaaagaagaggcattcggaagtctgataaaaggt
atgaaggatgagaaaaataagcgtctgaaacaaagacaattatatcctggcgcaccaaaa
ggacaattcaaacaatttaagcatggtttaagttcatttattgaagcattagaacaagat
gttattaaaaagggtgtatcaattcaatataatacgacagtagatgatattattacatct
caaaagcaatataaaattgtttacagtgatcaactagaagaagtgtatgatggcgtatta
gtaacgacaccacatcaagtgtttttaaattggtttggtcaagatccagcttttgattat
tttaaaacaatggatagtacaacggttgccactgtagtattagcatttgatgaaaaggat
attgaaaatacttatgatggtactggattcgttatagcaagaacaagtgatacagacatt
acagcttgtacttggacatcgaaaaaatggccatttactacaccagaaggtaaggttttg
attcgtgcgtatgtaggtaaaccaggtgatactgtggttgatgatcatacagataatgaa
ttagtatcgattgtacgtagagatttaagtcaaatgatgacatttaaaggtgatcctgaa
tttacaattgtcaatcgtttgccgaaaagtatgccacagtaccatgtcggtcatattcaa
caaattagacagattcaagcacatattaaacaaacatatccacgacttagagtaactggt
gcatcttttgaagcggttggactacctgattgtattacgcaaggtaaagttgctgctgaa
gaagtaatcgcagagttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system