KEGG   Staphylococcus aureus Bmb9393: SABB_02275Help
Entry
SABB_02275        CDS       T02717                                 

Definition
(GenBank) acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saur  Staphylococcus aureus Bmb9393
Pathway
saur00071  Fatty acid degradation
saur00072  Synthesis and degradation of ketone bodies
saur00280  Valine, leucine and isoleucine degradation
saur00310  Lysine degradation
saur00362  Benzoate degradation
saur00380  Tryptophan metabolism
saur00620  Pyruvate metabolism
saur00630  Glyoxylate and dicarboxylate metabolism
saur00640  Propanoate metabolism
saur00650  Butanoate metabolism
saur00900  Terpenoid backbone biosynthesis
saur01100  Metabolic pathways
saur01110  Biosynthesis of secondary metabolites
saur01120  Microbial metabolism in diverse environments
saur01130  Biosynthesis of antibiotics
saur01200  Carbon metabolism
saur01212  Fatty acid metabolism
saur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saur00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SABB_02275
   00630 Glyoxylate and dicarboxylate metabolism
    SABB_02275
   00640 Propanoate metabolism
    SABB_02275
   00650 Butanoate metabolism
    SABB_02275
  Lipid metabolism
   00071 Fatty acid degradation
    SABB_02275
   00072 Synthesis and degradation of ketone bodies
    SABB_02275
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SABB_02275
   00310 Lysine degradation
    SABB_02275
   00380 Tryptophan metabolism
    SABB_02275
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SABB_02275
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SABB_02275
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SABB_02275
Enzymes [BR:saur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SABB_02275
Exosome [BR:saur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SABB_02275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AGP27355
Position
416550..417731
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacggtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgtagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgattaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacatcctattggtgcatctggtgctagagtattagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system