KEGG   Staphylococcus aureus subsp. aureus SA40 (CA-MRSA): SA40_1878Help
Entry
SA40_1878         CDS       T02849                                 

Definition
putative thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
saus  Staphylococcus aureus subsp. aureus SA40 (CA-MRSA)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saus00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SA40_1878
Enzymes [BR:saus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SA40_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2078026..2078625)
Genome map
AA seq 199 aa AA seqDB search
MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
NAIEAINISKASEIMTHDLTNVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLDMDF
RGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYE
PRCRAHHIVAPSDNNKEEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaacttaccattccggttggatagaatgtattacaggtagtatgtttagcggt
aaatccgaagaacttataagacgtttaagaaggggcatatacgctaaacaaaaagtcgtt
gtatttaaaccggcgattgatgatcgatatcataaagaaaaagtggtctctcataatggt
aatgccattgaagcgattaatatttctaaagcaagtgaaattatgacgcacgacttaact
aatgttgatgttataggaatagacgaagtgcaattttttgacgatgaaattgtaagtata
gtagaaaaactatcagcagatggacaccgtgttattgttgctggattagatatggatttt
aggggcgaaccgttcgaaccaatgcctaaattgatggctgtcagtgaacaagtaacgaaa
cttcaagcagtttgtgctgtttgtggttcttcatctagtagaacgcaacgattaataaat
ggtaaaccagctaaaatcgatgatccgattatcttagtgggtgccaatgaaagttatgag
ccacgttgtcgtgcgcaccatatcgtagcacctagtgataataataaggaggaattataa

DBGET integrated database retrieval system