KEGG   Staphylococcus aureus subsp. aureus ST228/10388 (MRSA): SAI1T1_2002720Help
Entry
SAI1T1_2002720    CDS       T03143                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase (Acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saut  Staphylococcus aureus subsp. aureus ST228/10388 (MRSA)
Pathway
saut00071  Fatty acid degradation
saut00072  Synthesis and degradation of ketone bodies
saut00280  Valine, leucine and isoleucine degradation
saut00310  Lysine degradation
saut00362  Benzoate degradation
saut00380  Tryptophan metabolism
saut00620  Pyruvate metabolism
saut00630  Glyoxylate and dicarboxylate metabolism
saut00640  Propanoate metabolism
saut00650  Butanoate metabolism
saut00900  Terpenoid backbone biosynthesis
saut01100  Metabolic pathways
saut01110  Biosynthesis of secondary metabolites
saut01120  Microbial metabolism in diverse environments
saut01130  Biosynthesis of antibiotics
saut01200  Carbon metabolism
saut01212  Fatty acid metabolism
saut02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saut00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAI1T1_2002720
   00630 Glyoxylate and dicarboxylate metabolism
    SAI1T1_2002720
   00640 Propanoate metabolism
    SAI1T1_2002720
   00650 Butanoate metabolism
    SAI1T1_2002720
  Lipid metabolism
   00071 Fatty acid degradation
    SAI1T1_2002720
   00072 Synthesis and degradation of ketone bodies
    SAI1T1_2002720
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI1T1_2002720
   00310 Lysine degradation
    SAI1T1_2002720
   00380 Tryptophan metabolism
    SAI1T1_2002720
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAI1T1_2002720
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAI1T1_2002720
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAI1T1_2002720
Enzymes [BR:saut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAI1T1_2002720
Exosome [BR:saut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAI1T1_2002720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: CCJ10253
Position
374425..375606
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQHKAVCAQQNGEFDSEIVPVSIPQRKGEPILVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQLLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcag
tcaccaatgcttgtcaacaacagtcgcttcggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacataaagcagtatgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcttagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgcttaagaccagctttcaaaaaagacggg
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggcgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaattattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system