KEGG   Staphylococcus aureus subsp. aureus Z172: SAZ172_2722Help
Entry
SAZ172_2722       CDS       T02886                                 

Definition
aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sauz  Staphylococcus aureus subsp. aureus Z172
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sauz00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sauz00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sauz00250]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:sauz00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2853935..2855272)
Genome map
AA seq 445 aa AA seqDB search
MSKAHQLIQEDEHYFAKSGRIKYYPLVIDHGYGATLVDIEGKTYIDLLSSASSQNVGHAP
REVTEAIKAQVDKFIHYTPAYMYHEPLVRLAKKLCEIAPGDFEKRVTFGLTGSDANDGII
KFARAYTGRPYIISFTNAYHGSTFGSLSMSAISLNMRKHYGPLLNGFYHIPFPDKYRGMY
EQPQANSVEEYLAPLKEMFAKYVPADEVACIVIETIQGDGGLLEPVPGYFEALENICREN
GILIAVDDIQQGFGRTGTWSSVSHFNFTPDLITFGKSLAGGMPMSAIVGRKEIMNCLEAP
AHLFTTGANPVSCEAALATIQMIEDQSLLQASAEKGEYVRKRMDQWVSKYNSVGDVRGKG
LSIGIDIVSDKNLKTRDASAALKICNYCFEHGVVIIAVAGNVLRFQPPLVITYEQLDTAL
NTIEDALTALEAGNLDQYDISGQGW
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcacatcaattaattcaagaggatgaacattattttgcgaaatcaggacgt
attaaatattatccgttagttattgatcatggatatggagcaacattggttgatattgag
ggaaagacatatatcgatttgttatcgagtgcgagttctcaaaacgtaggtcatgcacct
agagaagtaacagaagcgataaaggcacaagttgataaatttattcattatacaccagca
tatatgtatcatgaaccgttggtacgtttagctaagaagctttgtgagattgcacctgga
gattttgaaaaaagagtgaccttcggattaactggatcagacgcaaatgatggcatcatt
aaatttgccagagcatatacagggcgtccttatatcattagtttcactaatgcatatcat
ggttcaacttttggctcgttgtctatgtcagctattagtttaaatatgcgcaaacattat
ggtccgttattgaatggcttttatcatattccgtttccagataaatatcgtggtatgtac
gagcagccacaagctaattcagtagaagaatatttagcacccttaaaagaaatgtttgcg
aaatatgtacctgctgacgaagtagcatgtattgttattgaaacgatacaaggcgatggt
ggacttttagaaccagttccagggtattttgaagcgttagaaaatatttgtcgtgaaaat
ggtattttaatcgctgtcgatgatattcaacaaggttttgggagaacaggtacatggagt
tcagtctcgcattttaattttacgcctgatttaatcactttcggaaaatctttagcaggt
ggtatgcctatgtcagcaattgttggacgcaaagagattatgaattgtttagaagcacca
gcacatttatttacaacaggtgctaatccagttagttgtgaagctgcattagccacaatt
caaatgattgaagatcagtcgcttcttcaggctagtgcggaaaaaggggaatatgttagg
aaacgaatggatcaatgggtatctaaatacaatagtgtaggcgatgttagaggtaaaggc
ctgagcattggtattgatattgtttccgacaaaaacctcaaaacacgtgatgccagtgcg
gcacttaaaatttgtaattactgctttgagcatggcgtagttattatagctgtagcagga
aatgtgttgcgattccaaccgccattggtaataacatatgagcaattagacacggcgtta
aacactatagaagatgcactgactgctttggaagcaggaaacttagatcaatatgacata
tctggacaaggttggtaa

DBGET integrated database retrieval system