KEGG   Staphylococcus aureus subsp. aureus Z172: SAZ172_2722Help
Entry
SAZ172_2722       CDS       T02886                                 

Definition
aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sauz  Staphylococcus aureus subsp. aureus Z172
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SAZ172_2722
   00650 Butanoate metabolism
    SAZ172_2722
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAZ172_2722
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAZ172_2722
Enzymes [BR:sauz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SAZ172_2722
Amino acid related enzymes [BR:sauz01007]
 Aminotransferase (transaminase)
  Class III
   SAZ172_2722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2853935..2855272)
Genome map
AA seq 445 aa AA seqDB search
MSKAHQLIQEDEHYFAKSGRIKYYPLVIDHGYGATLVDIEGKTYIDLLSSASSQNVGHAP
REVTEAIKAQVDKFIHYTPAYMYHEPLVRLAKKLCEIAPGDFEKRVTFGLTGSDANDGII
KFARAYTGRPYIISFTNAYHGSTFGSLSMSAISLNMRKHYGPLLNGFYHIPFPDKYRGMY
EQPQANSVEEYLAPLKEMFAKYVPADEVACIVIETIQGDGGLLEPVPGYFEALENICREN
GILIAVDDIQQGFGRTGTWSSVSHFNFTPDLITFGKSLAGGMPMSAIVGRKEIMNCLEAP
AHLFTTGANPVSCEAALATIQMIEDQSLLQASAEKGEYVRKRMDQWVSKYNSVGDVRGKG
LSIGIDIVSDKNLKTRDASAALKICNYCFEHGVVIIAVAGNVLRFQPPLVITYEQLDTAL
NTIEDALTALEAGNLDQYDISGQGW
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcacatcaattaattcaagaggatgaacattattttgcgaaatcaggacgt
attaaatattatccgttagttattgatcatggatatggagcaacattggttgatattgag
ggaaagacatatatcgatttgttatcgagtgcgagttctcaaaacgtaggtcatgcacct
agagaagtaacagaagcgataaaggcacaagttgataaatttattcattatacaccagca
tatatgtatcatgaaccgttggtacgtttagctaagaagctttgtgagattgcacctgga
gattttgaaaaaagagtgaccttcggattaactggatcagacgcaaatgatggcatcatt
aaatttgccagagcatatacagggcgtccttatatcattagtttcactaatgcatatcat
ggttcaacttttggctcgttgtctatgtcagctattagtttaaatatgcgcaaacattat
ggtccgttattgaatggcttttatcatattccgtttccagataaatatcgtggtatgtac
gagcagccacaagctaattcagtagaagaatatttagcacccttaaaagaaatgtttgcg
aaatatgtacctgctgacgaagtagcatgtattgttattgaaacgatacaaggcgatggt
ggacttttagaaccagttccagggtattttgaagcgttagaaaatatttgtcgtgaaaat
ggtattttaatcgctgtcgatgatattcaacaaggttttgggagaacaggtacatggagt
tcagtctcgcattttaattttacgcctgatttaatcactttcggaaaatctttagcaggt
ggtatgcctatgtcagcaattgttggacgcaaagagattatgaattgtttagaagcacca
gcacatttatttacaacaggtgctaatccagttagttgtgaagctgcattagccacaatt
caaatgattgaagatcagtcgcttcttcaggctagtgcggaaaaaggggaatatgttagg
aaacgaatggatcaatgggtatctaaatacaatagtgtaggcgatgttagaggtaaaggc
ctgagcattggtattgatattgtttccgacaaaaacctcaaaacacgtgatgccagtgcg
gcacttaaaatttgtaattactgctttgagcatggcgtagttattatagctgtagcagga
aatgtgttgcgattccaaccgccattggtaataacatatgagcaattagacacggcgtta
aacactatagaagatgcactgactgctttggaagcaggaaacttagatcaatatgacata
tctggacaaggttggtaa

DBGET integrated database retrieval system