KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV0183Help
Entry
SAV0183           CDS       T00052                                 

Gene name
argJ
Definition
bifunctional ornithine acetyltransferase/N-acetylglutamate synthase (EC:2.3.1.1 2.3.1.35)
Orthology
K00620  
glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:sav01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sav01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sav00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(206844..208085)
Genome map
AA seq 413 aa AA seqDB search
MKHQETTSQQYNFSIIKHGDISTPQGFTAGGMHIGLRANKKDFGWIYSSSLASSAAVYTL
NQFKAAPLIVTEDTLQKSKGKLQALVVNSANANSCTGQQGIDDARQTQTWVAQQLQIPSE
HVAVASTGVIGEYLPMDKIKTGTEHIKDTNFATPGAFNEAILTTDTCTKHIAVSLKIDGK
TVTIGGSAKGSGMIHPNMATMLAFITTDASIESNTLHQLLKSSTDHTFNMITVDGDTSTN
DMVLVMANHQVEHQILSQDHPQWETFVDAFNFVCTFLAKAIARDGEGATKLISVNVSGAK
SISDARKIGKTIVSSNLVKSAIFGEDANFGRIITAIGYSGCEIDPKCTYVQLNQIPVVDK
GMAVLFDEQAMSNTLTHEHVTIDVQLGLGNAAATAYGCDLSYDYVRINASYRT
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcaagaaacgacatcacaacaatataacttttcaattattaaacatggcgat
atcagtacacctcaaggcttcacggctggtggtatgcacatcggtttacgcgctaacaaa
aaagactttgggtggatttactcatcgtctttggcaagttcagctgccgtatatacttta
aatcagtttaaagctgcaccacttattgtcactgaagacactttacaaaagtctaaagga
aaattacaagcacttgttgttaattcagctaatgcaaattcttgtaccggtcaacaaggc
atagatgatgcacgacaaacacaaacatgggttgctcaacaacttcaaataccatctgag
catgttgctgttgcttcaactggggtcattggtgaatatttgcctatggataaaattaag
actgggaccgaacatattaaggatactaattttgcaacgccaggtgcgtttaacgaggca
attttaacaactgatacctgtacaaaacatatcgctgtatcactaaaaatcgatggtaaa
accgttacaattggtggtagcgccaaaggttcaggtatgattcatccaaatatggctacc
atgcttgcttttataacaaccgatgcatcgattgaatcgaatacacttcatcaattatta
aaatcttcgactgaccatacatttaatatgattactgttgatggcgatacaagtacaaat
gacatggtattagtcatggcaaatcaccaagttgaacaccaaatacttagtcaagaccat
ccacaatgggaaacatttgttgatgcattcaattttgtctgtacatttttagctaaagct
atagccagagatggcgaaggcgcaacaaagttaatcagcgtcaatgtgtcaggcgctaaa
tcaatatcagatgcaagaaaaatcggtaaaactatcgtaagttcaaatctagtaaaatca
gctatttttggcgaagatgccaattttggtcgaatcattacagctattggctatagcgga
tgtgaaattgatcctaaatgcacatatgttcaactgaaccaaatacctgtcgtggataaa
ggtatggctgtactatttgatgagcaagctatgtcgaacacattaactcatgaacatgtc
acaattgacgttcaacttggtttaggtaacgctgcagcgactgcatacggttgtgattta
tcctatgattatgtgcgtattaacgcatcatatcgaacataa

DBGET integrated database retrieval system