KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV0227Help
Entry
SAV0227           CDS       T00052                                 

Gene name
pflA
Definition
(GenBank) formate acetyltransferase activating enzyme
  KO
K04069  pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Brite
Enzymes [BR:sav01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     SAV0227 (pflA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_12 Fer4_14
Motif
Other DBs
NCBI-ProteinID: BAB56389
UniProt: Q99WZ6
Position
261098..261853
Genome map
AA seq 251 aa AA seqDB search
MLKGHLHSVESLGTVDGPGLRYILFTQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEI
LPYKPYFDASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDTKAFQRH
FEELQKHTDLILLDIKHIDNDKHIRLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD
DKDDLIKLGEFINSLDNVEKFEILPYHQLGVHKWKTLGIAYELEDVEAPDDEAVKAAYRY
VNFKGKIPVEL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagggacacttacattctgtcgaaagtttaggtactgtcgatggaccgggatta
agatatatattatttacacaaggatgcttacttagatgcttgtattgccacaatccagat
acttggaaaattagtgagccatcaagagaagtcacagttgatgaaatggtgaatgaaata
ttaccatacaaaccatactttgatgcatcgggtggcggtgtaacagtcagtggtggcgaa
ccattgttacaaatgccattcttagaaaaattatttgcggaattaaaagaaaatggtgtg
cacacttgcttagacacatcggctggatgtgctaatgatacaaaagcatttcaaaggcat
tttgaagaattacaaaaacatacagacttgatattattagatataaaacatattgataat
gacaaacatattagattgacaggaaagcctaatacacacatccttaacttcgcgcgcaaa
ctgtcagatatgaaacaacctgtatggattcgacatgtccttgtgcctggttattctgat
gataaagacgatttaattaaactaggggaattcattaattctcttgataacgtcgaaaag
tttgaaattctgccatatcatcagttaggtgttcataagtggaaaacattgggcattgca
tatgaattagaagatgtcgaagcgcccgatgatgaagctgttaaagcagcctaccgttat
gttaacttcaaagggaaaattcccgttgaattataa

DBGET integrated database retrieval system