KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV0556Help
Entry
SAV0556           CDS       T00052                                 

Definition
(GenBank) deoxypurine kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav00230  Purine metabolism
sav00240  Pyrimidine metabolism
sav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sav00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SAV0556
   00240 Pyrimidine metabolism
    SAV0556
Enzymes [BR:sav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     SAV0556
    2.7.1.76  2'-deoxyadenosine kinase
     SAV0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_17 AAA_15 AAA_28 Cytidylate_kin2 RsgA_GTPase ABC_tran TsaE AAA_22 ATPase RNA_helicase MMR_HSR1 AAA_33 NB-ARC AAA Cytidylate_kin AAA_14 AAA_16 AAA_29 AAA_25 PduV-EutP ATP_bind_1 GTP_EFTU NACHT NTPase_1 DUF1087 APS_kinase ParA AAA_5
Motif
Other DBs
NCBI-ProteinID: BAB56718
UniProt: A0A0H3JQ18
Position
complement(625619..626281)
Genome map
AA seq 220 aa AA seqDB search
MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFERWSF
HLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSDLFN
AMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINSFNA
CPVVRININEYDIHKDPESLNPMIDKIARIIQTYRQVDTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaataattacggtattccacaaaatgccattataaccattgcaggtacagttggtgtt
ggaaaatcaacactaacgcaagcacttgcagataaattaaactttaaaacgtcttttgaa
aatgtcgaacataatccatatttagataaattttatagcgattttgaacgatggagtttc
catttgcaaatttacttcttagctgaacgttttaaagaacaaaagcgtatgtttgaatat
ggtggtggctttgtccaagatcgatcaatttatgaagatgttgatatttttgcaaaaatg
catgaagaagaaggcacaatgagtaaagaagatttcaaaacatattcagacttatttaat
gccatggtcatgacaccttattttcctaaaccagatgtaatgatttatttagaatgtaac
tatgatgaggtcattgatcgtattattgaacgtggtcgcgaaatggaaattaatacagac
cctgaatactggaaaaagctatttaaacgctatgacgattggattaatagctttaatgca
tgtccagttgtacgtatcaatattaatgaatatgatatccataaggaccccgaatcttta
aatcctatgatagacaaaattgctcgaattattcaaacatatcgacaagtagatacacga
taa

DBGET integrated database retrieval system