KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV0605Help
Entry
SAV0605           CDS       T00052                                 

Gene name
adh1
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sav00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAV0605 (adh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAV0605 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    SAV0605 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAV0605 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAV0605 (adh1)
   00626 Naphthalene degradation
    SAV0605 (adh1)
Enzymes [BR:sav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAV0605 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
679804..680814
Genome map
AA seq 336 aa AA seqDB search
MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQ
VIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNVKPGQWLGVFGIGGLGNLALQY
AKNVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNKGLDATVVTSVA
KTPFNQAVDVVKAGARVVAVGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQDLREAFEFAA
ENKVTPKVQLRKLEEINDIFEEMEKGTITGRMVIKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcagttgtaacgaaagatcacaaagtaagtattgaggacaaaaagttaaga
gctttaaaacctggtgaagcattggtacaaacggaatattgtggtgtttgtcataccgat
ttacatgttaagaatgctgattttggtgatgttacaggcgttactttaggtcatgaaggt
attggtaaagtcatcgaagttgcagaagatgtagaatcattaaaaattggagaccgtgtg
tctatcgcttggatgttcgaaagctgtggaagatgtgaatattgtacaacaggtcgtgaa
acactttgccgtagtgtgaaaaatgctggttatacagtagatggtgcaatggctgaacaa
gttattgttactgcagactatgctgtgaaagtacctgaaaaattagatccagcagcagcg
tcttctattacatgcgcaggtgtgacaacttataaagctgtaaaagtaagtaatgtaaaa
cctggtcaatggttaggtgtttttggtataggtggtttaggtaacctagctttacaatat
gctaaaaacgttatgggggctaaaattgttgccttcgacattaatgatgataaattagca
ttcgcgaaagaattaggtgcagatgctattattaattctaaagatgttgatccagttgca
gaagttatgaaattaactgataacaaaggattagatgcaacagtggtaacttcagttgct
aagacgccatttaaccaagcggttgatgttgtaaaagctggtgcaagagttgttgccgtt
ggtttacctgttgataaaatgaacttagatatcccaagattagtgcttgacggtattgaa
gtagtaggttcacttgttggtacaagacaagacttacgtgaagcgtttgaatttgctgct
gaaaataaagtaacacctaaagttcaattaagaaaattagaagaaatcaatgatattttt
gaagaaatggaaaagggtactataactggtagaatggttattaaattttaa

DBGET integrated database retrieval system