KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV1197Help
Entry
SAV1197           CDS       T00052                                 

Definition
ribosomal large subunit psudouridine synthase D
Orthology
K06180  
23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1252795..1253712
Genome map
AA seq 305 aa AA seqDB search
METYEFNITDKEQTGMRVDKLLPELNNDWSRNQIQDWIKAGLVVANDKVVKSNYKVKLND
HIVVTEKEVVEADILPENLNLDIYYEDDDVAVVYKPKGMVVHPSPGHYTNTLVNGLMYQI
KNLSGINGEIRPGIVHRIDMDTSGLLMVAKNDIAHRGLVEQLMDKSVKRKYIALVHGNIP
HDYGTIDAPIGRNKNDRQSMAVVDDGKEAVTHFNVLEHFKDYTLVECQLETGRTHQIRVH
MKYIGFPLVGDPKYGPKKTLDIGGQALHAGLIGFEHPVTGEYIERHAELPQDFEDLLDTI
RKRDA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggagacttatgaatttaacattacagataaagaacaaacaggtatgcgtgtagataag
ttgctgcctgaattaaataatgattggtctcgtaaccagatacaagattggattaaagca
ggtttagtcgttgcaaacgataaagttgttaaatctaattataaagtgaaacttaatgat
catatagttgtcactgaaaaagaagtggttgaagctgatattctacctgaaaatttaaat
ttagatatttattatgaagatgacgatgttgcagttgtatataaaccgaaaggcatggta
gttcatccatcaccagggcattataccaatacattagttaatggtttaatgtatcaaatt
aaaaatttgtcaggtattaatggagaaattcgtccaggtattgttcaccgtatagatatg
gatacttctggtttattaatggttgctaaaaatgatattgctcatcgtgggcttgtagaa
caattaatggataaatctgttaaaagaaaatatatcgctttagttcacgggaatattcct
catgattacggtacaatcgatgcgccaattggtagaaacaaaaatgatcgtcaatctatg
gctgttgttgatgatggtaaggaagcagtgacacattttaacgtactagaacattttaaa
gattatacgcttgttgaatgtcaacttgaaacaggacgtacgcatcaaatccgtgtgcac
atgaaatatattggcttcccattagttggtgatccaaagtatggaccgaaaaagacattg
gatattggtggtcaagctctacatgctggacttattggattcgaacatccagtaacaggt
gaatatattgaaagacatgctgaattaccacaagactttgaagatttattagatacaatt
cgaaaaagagatgcataa

DBGET integrated database retrieval system