KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV1245Help
Entry
SAV1245           CDS       T00052                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav00020  Citrate cycle (TCA cycle)
sav00640  Propanoate metabolism
sav00660  C5-Branched dibasic acid metabolism
sav01100  Metabolic pathways
sav01110  Biosynthesis of secondary metabolites
sav01120  Microbial metabolism in diverse environments
sav01130  Biosynthesis of antibiotics
sav01200  Carbon metabolism
Module
sav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sav00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAV1245 (sucC)
   00640 Propanoate metabolism
    SAV1245 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SAV1245 (sucC)
Enzymes [BR:sav01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SAV1245 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: BAB57407
UniProt: P66871
Position
1307588..1308754
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVYVVKAQIHAGGRGKAGGV
KIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQ
VTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKF
LLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHKDVVELRDLEEEDP
KEIEASKHDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDAGGSATREKVTE
AFKIILGDENVKGIFVNIFGGIMKCDVIAEGIVEAVKEVDLTLPLVVRLEGTNVELGKKI
LKDSGLAIEPAATMAEGAQKIVKLVKEA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgagtatcaaggtaaagaaatatttcgttcaatgggcgttgcagttcca
gaaggacgagtagcatttactgctgaagaagcggtggagaaagcaaaagaattaaattct
gatgtatatgttgtaaaagcacaaattcatgctggaggtagaggtaaagcaggcggagta
aaaattgctaaatctttatctgaggtagaaacatatgcaaaagaattattagggaaaact
ttggtgacacatcaaactggtccagaaggtaaagaaattaaacgtttatatatcgaagaa
ggttgtgctattcaaaaagaatattacgttggattcgttattgatcgtgcgactgaccaa
gtaacattgatggcgtctgaagaagggggcactgagattgaagaagttgctgcgaagact
cctgaaaagatcttcaaagaaactatcgatccagtaatcggactttcaccattccaagca
agacgaattgcgtttaatattaatattcctaaagaatctgttaacaaagctgctaaattc
ttattagcactttataatgtattcattgaaaaagattgttcaatcgtagaaatcaaccca
ttagttacaacagctgatggtgatgtattggcattagatgctaaaattaattttgatgat
aatgcattattcagacataaagatgttgtagaattacgtgatttagaagaagaagatccg
aaagagattgaagcgtctaaacatgatttatcatacattgcattagatggtgacatcgga
tgtatggttaatggtgcaggtttagccatggcaacaatggatacgattaatcatttcggt
ggaaacccagccaatttcttagatgcaggcggaagcgctactagagaaaaagtaactgaa
gcatttaaaatcattttaggtgatgaaaatgttaaaggtatttttgtaaacattttcggt
ggcattatgaaatgtgatgttatcgcagaaggtatcgttgaagctgtaaaagaagtagat
ttaactttaccactagttgtacgcttagaaggtacaaatgttgagttaggtaaaaaaatc
ttaaaagactcaggattagcaattgaaccagcagcaacaatggctgaaggtgcacaaaaa
attgttaaactagtcaaagaagcataa

DBGET integrated database retrieval system