KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0147Help
Entry
SAHV_0147         CDS       T00588                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAHV_0147 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAHV_0147 (adhE)
   00620 Pyruvate metabolism
    SAHV_0147 (adhE)
   00650 Butanoate metabolism
    SAHV_0147 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SAHV_0147 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAHV_0147 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAHV_0147 (adhE)
   00626 Naphthalene degradation
    SAHV_0147 (adhE)
Enzymes [BR:saw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAHV_0147 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SAHV_0147 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
164417..167026
Genome map
AA seq 869 aa AA seqDB search
MLTIPEKENRGSKEQEVAIMIDALADKGKKALEALSKKSQEEIDHIVHQMSLAAVDQHMV
LAKLAHEETGRGIYEDKAIKNLYASEYIWNSIKDNKTVGIIGEDKEKGLTYVAEPIGVIC
GVTPTTNPTSTTIFKAMIAIKTGNPIIFAFHPSAQESSKRAAEVVLEAAMKAGAPKDIIQ
WIEVPSIEATKQLMNHKGIALVLATGGSGMVKSAYSTGKPALGVGPGNVPSYIEKTAHIK
RAVNDIIGSKTFDNGMICASEQVVVIDKEIYKDVTNEFKAHQAYFVKKDELQRLENAIMN
EQKTGIKPDIVGKSAVEIAELAGIPVPENTKLIIAEISGVGSDYPLSREKLSPVLALVKA
QSTKQAFQICEDTLHFGGLGHTAVIHTEDETLQKDFGLRMKACRVLVNTPSAVGGIGDMY
NELIPSLTLGCGSYGRNSISHNVSATDLLNIKTIAKRRNNTQIFKVPAQIYFEENAIMSL
TTMDKIEKVMIVCDPGMVEFGYTKTVENVLRQRTEQPQIKIFSEVEPNPSTNTVYKGLEM
MVDFQPDTIIALGGGSAMDAAKAMWMFFEHPETSFFGAKQKFLDIGKRTYKIGMPENATF
ICIPTTSGTGSEVTPFAVITDSETNVKYPLADFALTPDVAIIDPQFVMSVPKSVTADTGM
DVLTHAMESYVSVMASDYTRGLSLQAIKLTFEYLKSSVEKGDKVSREKMHNASTLAGMAF
ANAFLGIAHSIAHKIGGEYGIPHGRANAILLPHIIRYNAKDPQKHALFPKYEFFRADTDY
ADIAKFLGLKGNTTEALVESLAKAVYELGQSVGIEMNLKSQGVSEEELNESIDRMAELAF
EDQCTTANPKEALISEIKDIIQTSYDYKQ
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgttaactatacctgaaaaagaaaatcgtggatcgaaagaacaagaagtggcaattatg
attgatgctctagctgacaaagggaaaaaagcattagaagcattatctaaaaagtcacaa
gaagaaattgatcatattgttcatcaaatgagcttagcagctgttgatcaacatatggtg
ctagcaaaattagcacatgaagaaactggaagaggtatatacgaagataaagcgattaaa
aatttatacgcttctgaatatatatggaattcaataaaagacaataagacagtagggatt
attggtgaagataaagaaaaaggattaacgtatgtagcggaaccaattggtgttatttgt
ggtgttacgccaacaacaaatcctacgtcgacaactatttttaaagcgatgattgcaatt
aagacaggaaatccaatcatttttgcattccatccaagtgcacaagaatcgtcgaagcgt
gcagcagaagttgtattagaagcggcaatgaaggcaggtgcacctaaagatattattcag
tggattgaagtgccttctatcgaagcaacaaaacaattaatgaatcacaaaggtattgca
ttagttctagcaacaggtggttcgggcatggttaagtctgcatattcaactggcaaaccg
gcattaggtgtgggaccaggtaacgtgccgtcttacattgaaaaaacagcacacattaaa
cgtgcagtaaatgatatcattggttcaaaaacatttgataatggtatgatttgtgcttct
gaacaagttgtagtcattgataaagaaatttataaagatgttactaatgaatttaaagca
catcaagcatactttgttaaaaaagatgaattacaacgcttagaaaatgcaattatgaat
gaacaaaaaacaggtattaagcctgatattgtcggtaaatctgcagttgaaatagctgaa
ttagcaggtatacctgtccccgaaaatacaaaacttatcatagccgaaattagcggtgta
ggttcagactatccgttatctcgtgaaaaattatctccagtattagccttagtaaaagcc
caatctacaaaacaagcatttcaaatttgtgaagacacactacattttggtggattagga
cacacagccgttatccatacagaagatgaaacattacaaaaagattttggactaagaatg
aaagcttgtcgtgtacttgtaaatacaccatcagcggttggaggtattggtgatatgtat
aacgaattgattccgtctttaacattaggttgtggttcgtacggtagaaactcaatttca
cataatgttagtgcgacagatttattaaacattaaaacgattgctaaacgacgtaataat
actcaaattttcaaggtgcctgctcaaatttattttgaagaaaatgcaatcatgagtcta
acaacaatggacaagattgaaaaagtgatgattgtctgtgaccctggtatggtagaattc
ggttatacaaaaacagttgagaatgtattaagacaaagaacggaacagcctcaaattaaa
atatttagcgaagtcgaaccgaacccatcaactaatacagtatataaaggtctggaaatg
atggttgatttccaaccagatacaatcattgcacttggtggtggttcagcgatggatgct
gcaaaagcaatgtggatgttctttgaacaccctgagacatcattcttcggtgctaaacaa
aagttcctagacatcggtaaacgtacttataaaataggcatgcctgaaaatgcgacgttc
atttgtatccctacgacatcaggtacaggttcagaagtaacaccatttgcagttatcaca
gatagtgaaacaaatgtaaaatatccgttggctgattttgctttaacacctgacgttgca
attattgaccctcaatttgtgatgagtgtgccaaaaagcgttacagcagatacaggaatg
gatgtactaacgcatgcaatggaatcatatgtatctgtaatggcttcagactatacaaga
ggtttgagtctacaagcgattaaattgacgttcgaatatttaaaatcatctgttgaaaag
ggtgataaagtttcaagagagaaaatgcataacgcatcaactttggctggtatggcattt
gcaaatgcattcttaggcattgcacactcaattgcacataaaattggtggcgaatatggt
attccgcatggtagagcgaatgcgatattactaccgcatattatccgttataatgccaaa
gacccgcaaaaacatgcattattccctaaatatgagttcttcagagcagatacagattat
gcagatattgccaaattcttaggattaaaagggaatacgacagaagcactcgtagaatca
ttagctaaagctgtctacgaattaggtcaatcagtcggaattgaaatgaatttgaaatca
caaggtgtgtctgaagaagaattaaatgaatcaattgatagaatggcagagctcgcattt
gaagatcaatgtacaactgctaatcctaaagaagcactaatcagtgaaatcaaagatatc
attcaaacatcatatgattataagcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system