KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0455Help
Entry
SAHV_0455         CDS       T00588                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
502808..503542
Genome map
AA seq 244 aa AA seqDB search
MRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNDQGFSCYAPNYPGHGLLLKD
FMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLAQHYPLKRIAVMSAPKE
KSDDGLIEHLVYYSQRMSNILNLDQQASSAQLAAIDDYEGEITKFQHFIDDIMTNLNVIK
IPANILFGGKDEPSYETSAHFIYEHLGSVDKELNGLKDSHHLMTHGEGRDILEENVIRFF
NALT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagaattaaaacaccgagtccatcttatttaaaaggcacaaatggacatgcgatatta
ttattacattcatttacaggtacaaatcgggatgtgaagcatcttgcagctgagttaaat
gaccaaggatttagttgttatgcaccgaattatccaggtcatggtttactgttgaaagat
ttcatgacatataatgtagatgattggtgggaagaagttgagaaagcttaccaattttta
gtcaatgaaggttatgaatctatcagtgcaacgggtgtgtctttaggtggattaatgaca
ttaaaattggcgcagcactacccgttgaaacgtatcgctgtcatgtcagcaccaaaggaa
aaaagtgatgatggcttaatagaacatttagtttattatagtcaacgcatgtcgaatatt
ttaaatttagatcagcaagcatcgagtgcgcaattagcagcaattgatgattatgaaggt
gaaattacgaagtttcagcattttattgatgatatcatgacaaatttaaatgttattaaa
attccagctaatatattatttggtggtaaagatgagccatcctatgaaacaagtgcacat
tttatttatgaacatttaggatcagtagacaaagaattaaatggtctgaaggattcgcat
catttaatgacacatggagaaggcagagatattttagaagaaaatgttattcgctttttc
aatgctttaacataa

DBGET integrated database retrieval system