KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0535Help
Entry
SAHV_0535         CDS       T00588                                 

Gene name
rplK
Definition
(GenBank) 50S ribosomal protein L11
  KO
K02867  
large subunit ribosomal protein L11
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:saw00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    SAHV_0535 (rplK)
Ribosome [BR:saw03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    SAHV_0535 (rplK)
  Bacteria
    SAHV_0535 (rplK)
  Archaea
    SAHV_0535 (rplK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
601810..602232
Genome map
AA seq 140 aa AA seqDB search
MAKKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISV
YEDRSFTFITKTPPAPVLLKKAAGIEKGSGEPNKTKVATVTKDQVREIANSKMQDLNAAD
EEAAMRIIEGTARSMGIVVE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaaaaagtagataaagttgttaaattacaaattcctgcaggtaaagcgaatcca
gcaccaccagttggtccagcattaggtcaagcaggtgtgaacatcatgggattctgtaaa
gagttcaatgcacgtactcaagatcaagcaggtttaattattccggtagaaatcagtgtt
tatgaagatcgttcatttacatttattacaaaaactccaccggctccagtattacttaaa
aaagcagctggtattgaaaaaggttcaggcgaaccaaacaaaactaaagttgctacagta
actaaagatcaagtacgcgaaattgctaacagcaaaatgcaagacttaaacgctgctgac
gaagaagcagctatgcgtattatcgaaggtactgcacgtagtatgggtatcgttgtagaa
taa

DBGET integrated database retrieval system