KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0536Help
Entry
SAHV_0536         CDS       T00588                                 

Gene name
rplA
Definition
(GenBank) 50S ribosomal protein L1
  KO
K02863  
large subunit ribosomal protein L1
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:saw00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    SAHV_0536 (rplA)
Ribosome [BR:saw03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    SAHV_0536 (rplA)
  Bacteria
    SAHV_0536 (rplA)
  Archaea
    SAHV_0536 (rplA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
602440..603132
Genome map
AA seq 230 aa AA seqDB search
MAKKGKKYQEAASKVDRTQHYSVEEAIKLAKETSIANFDASVEVAFRLGIDTRKNDQQIR
GAVVLPNGTGKSQSVLVFAKGDKIAEAEAAGADYVGEAEYVQKIQQGWFDFDVVVATPDM
MGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKAGIVHASIGKVSF
TDEQLIENFNTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGVKIDTASFK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaggtaaaaagtatcaagaagcagctagtaaagttgaccgtactcagcac
tacagtgttgaagaagcaattaaattagctaaagaaacaagcattgctaactttgacgct
tctgttgaagttgcattccgtttaggaattgatacacgtaaaaatgaccaacaaatccgt
ggtgcagttgtattaccaaacggaactggtaaatcacaaagtgtattagtattcgctaaa
ggtgacaaaattgctgaagctgaagcagcaggtgctgactatgtaggtgaagcagaatac
gttcaaaaaatccaacaaggttggttcgacttcgatgtagtagttgctacaccagacatg
atgggtgaagttggtaaattaggtcgtgtattaggaccaaaaggtttaatgccaaaccct
aaaactggaactgtaacaatggatgttaaaaaagctgttgaagaaatcaaagctggtaaa
gtagaatatcgtgctgaaaaagctggtatcgtacatgcatcaattggtaaagtttcattt
actgatgaacaattaattgaaaacttcaatactttacaagatgtattagctaaagctaaa
ccatcatctgctaaaggtacatacttcaaatctgttgctgtaactacaacaatgggtcct
ggagttaaaattgatactgcaagtttcaaataa

DBGET integrated database retrieval system