KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0549Help
Entry
SAHV_0549         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K05523  
D-lactate dehydratase / protein deglycase [EC:4.2.1.130 3.5.1.124]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Pyruvate metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAHV_0549
Enzymes [BR:saw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     SAHV_0549
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.130  D-lactate dehydratase
     SAHV_0549
Peptidases [BR:saw01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   SAHV_0549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
620752..621630
Genome map
AA seq 292 aa AA seqDB search
MSQDVNELSKQPTPDKAEDNAFFPSPYSLSQYTAPKTDFDGVEHKGAYKDGKWKVLMIAA
EERYVLLENGKMFSTGNHPVEMLLPLHHLMEAGFDVDVATLSGYPVKLELWAMPTEDEAV
ISTYNKLKEKLKQPKKLADVIKNELGPDSDYLSVFIPGGHAAVVGISESEDVQQTLDWAL
DNDRFIVTLCHGPAALLSAGLNREKSPLEGYSVCVFPDSLDEGANIEIGYLPGRLKWLVA
DLLTKQGLKVVNDDMTGRTLKDRKLLTGDSPLASNELGKLAVNEMLNAIQNK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagatgtaaatgaattaagtaagcaaccaacgccagataaagcagaagataac
gcatttttcccatcaccatattcccttagtcaatatacagcacctaaaacagattttgat
ggtgttgaacacaaaggtgcctataaagatggtaaatggaaagtattgatgattgctgct
gaagagagatatgtattattggaaaatggaaaaatgttctctacgggtaatcatcctgtt
gaaatgttattacctttacatcatttaatggaagcaggttttgacgttgatgttgcgaca
ttatctggttatccagttaaattagaattatgggctatgccaactgaagacgaggcagtt
ataagtacttataataaattgaaagaaaaattaaaacagccaaaaaaattagcagatgtg
attaaaaatgaattaggacctgattcagactatttatctgtctttatcccaggcggacat
gctgcagttgttggtatttctgaaagtgaggacgttcaacaaacattagattgggcatta
gacaatgaccgctttatagttacattatgtcatggaccagcagcactactttcagcaggg
cttaacagagaaaaatctccattagaaggatactctgtttgtgtcttccctgactcatta
gatgaaggtgcaaatattgaaataggttatttacctggacgcttgaaatggttagttgct
gatttattaactaaacaaggattaaaagtagttaacgacgatatgacaggaagaacgtta
aaagatcgtaaattattaacaggtgacagtcctttagcttcaaatgagttaggaaaatta
gcagttaatgaaatgttaaatgcaatacaaaataaataa

DBGET integrated database retrieval system