KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0553Help
Entry
SAHV_0553         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01091  
phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAHV_0553
Enzymes [BR:saw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     SAHV_0553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
626267..626950
Genome map
AA seq 227 aa AA seqDB search
MEWILFDKDGTLIEFDRSWEKIGVRFVQSLLETFPVHNKEAALRQLGVIKESIDPKSVMG
SGSLQQIIQAFNDVTGQDTTDWSKSTSQKLVDERIPEINWVEGVKEALIDLKAKGYQLGI
VTSDTKKGVEQFLAHTNAISLFDLIISTEADAYEKPNPKVLSPLFEQYNVDPQKVAIVGD
TANDMKTASNANLGMAIGVLTGIATKEELHEADIILNSAADILEALN
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaatggatattatttgataaagatggtacgttaattgaatttgatagaagttgggaa
aaaataggggtacgatttgtacaatcattgcttgagactttcccagtacataataaagaa
gctgctttaagacaactcggtgtcattaaagaatctattgatccaaaatcagtgatgggt
tcaggatctttacaacaaattatccaggcatttaatgatgtgacgggacaagatacaacc
gactggtccaagtcaacaagtcaaaagctggtagatgaacgtattcctgaaattaattgg
gtagaaggtgttaaagaagcacttatcgatttgaaagcaaaaggctatcaacttggtatt
gttacgagtgatactaaaaaaggtgtagaacaatttttagcacataccaatgctatctcg
ttgttcgatttgatcatttctaccgaagcggatgcctatgagaagccaaatcctaaagta
ttatcgcctttatttgagcaatataatgtagatcctcagaaagtagctatagtaggagac
actgctaatgatatgaagacagcaagtaatgcaaatttaggtatggcaataggtgtatta
acaggtattgcaacaaaagaagaattacatgaagctgatattattttaaatagtgcggca
gatattttagaagctttaaattaa

DBGET integrated database retrieval system