KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0563Help
Entry
SAHV_0563         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
  KO
K00712  
poly(glycerol-phosphate) alpha-glucosyltransferase [EC:2.4.1.52]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Brite
Enzymes [BR:saw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.52  poly(glycerol-phosphate) alpha-glucosyltransferase
     SAHV_0563
Glycosyltransferases [BR:saw01003]
 Polysaccharide
  Bacterial polysaccharide
   SAHV_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(643831..645321)
Genome map
AA seq 496 aa AA seqDB search
MNYFVGNSLGVNLTGIEKAIINRLNLFKEMGRPAQCVFLSWNRYLYRNAQNYITSSDYIN
MYDFFQEATYLERNEPFDWLSYWTDECHYTLKHVENSHDFRIYDQERFLMYAHFQDPKYR
ILDYVNHFDSQRRKVKRDFYDVRGFLSCSRILVDKQQTLCEFFYNPEGDTKLEKYFSYKD
GKPEVQKIIVYYANKQYFFNNETELGAFFIKQLYQHGDLFFSDRNVYTAPIFNLTPESIP
VVAVLHSTHIKNIDALDSSPFKNVYKAMFENLSRYRAIIVSTEQQKLDVEKRINHTIPIV
NIPVGYSETIDTPVQTLDQRSVKLISVARYSPEKQLHQQIELIKRLVSYVPKIELHMYGF
GSESKKLNELIQKYGLENHVYLRGFLSNLNQEYSDAYLSLITSNMEGFSLALLESLAHGV
PVISYDIKYGPNELITPDFNGYLITKNDEDALFDKVKYVIDHPEVQQRLSKGSLAKAQQY
SKASLIKQWDQFVRLI
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaattattttgtaggtaatagtttaggtgttaatttaactgggatagaaaaagcaatt
attaatcgtttaaatttatttaaagaaatgggaagaccagcgcaatgtgtatttctgtca
tggaatagatatttatatagaaatgcccaaaattatattactagttctgactatattaat
atgtatgatttcttccaagaagcaacatatttagaacgcaatgaaccatttgactggttg
tcgtattggactgatgaatgtcattatactttaaaacatgttgaaaatagtcatgacttt
agaatatatgatcaagagcgtttcttaatgtatgcccattttcaagatcctaaatatcgt
atattagattatgtgaatcattttgatagtcaaagacgaaaagtaaaacgtgatttttat
gatgtgcgtggctttttaagttgtagtaggattcttgttgataaacaacaaacattatgt
gaatttttctataatccagaaggtgacacaaaattagaaaagtatttttcttacaaggat
ggcaaaccagaagtacaaaaaattattgtttactatgctaacaaacaatatttctttaat
aatgaaacggaattaggcgcatttttcattaaacaactatatcaacatggggatttattt
ttcagtgaccgtaatgtgtatacagcacctattttcaacttaacacctgagtcaatccca
gtagtagctgtgcttcacagtacacacattaaaaatattgatgcattagattcatcgcca
tttaaaaatgtatataaagcgatgtttgaaaatttatctcgatatcgtgcaattatcgtt
tctactgagcagcaaaaattagatgttgaaaaacgtattaaccatactattccaattgtt
aatattcctgtcggctatagtgaaacaattgatacaccagtccaaacattagatcagcgc
agtgttaaattaatttccgttgctcgttattcacctgaaaaacaattacatcaacaaatt
gaattaattaaacgcttagtatcgtatgtcccaaaaatagagcttcatatgtatggtttt
ggttctgaaagtaaaaaattaaatgaattgatacaaaaatatggattggaaaatcatgtt
tacttacgtggctttttaagcaatctaaaccaagaatacagcgatgcttacttaagttta
ataacaagtaacatggaaggtttctctttagcgctacttgaatctttagcacatggtgtt
ccagttattagttatgatattaaatatggacctaacgaattgattacgcctgatttcaat
ggttatttaattactaaaaatgatgaagatgccctatttgataaagtaaaatatgtgatt
gatcatcctgaagtacaacaacgactgtcaaaaggtagtttggcaaaagcgcaacaatat
agtaaagcgtcgttaattaaacaatgggaccaatttgttcgtcttatataa

DBGET integrated database retrieval system