KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0568Help
Entry
SAHV_0568         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
  KO
K08093  
3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Pentose phosphate pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Formaldehyde assimilation, ribulose monophosphate pathway
Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAHV_0568
  Energy metabolism
   00680 Methane metabolism
    SAHV_0568
Enzymes [BR:saw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     SAHV_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
648646..649278
Genome map
AA seq 210 aa AA seqDB search
MELQLAIDLLNKEDAAELANKVKDYVDIVEIGTPIIYNEGLPAVKHMADNISNVKVLADM
KIMDAADYEVSQAIKFGADVITILGVAEDASIKAAIEEAHKNNKQLLVDMIAVQDLEKRA
KELDEMGADYIAVHTGYDLQAEGQSPLESLRTVKSVIKNSKVAVAGGIKPDTIKDIVAES
PDLVIVGGGIANADDPVEAAKQCRAAIEGK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtggaattacaattagcaattgatttattaaacaaagaagacgcggctgagttagcaaat
aaagtaaaagattatgtagatatcgtagaaatcggtacgccaatcatttacaacgaaggt
ttaccagcagttaaacatatggcagacaacattagtaatgtaaaagtattagcagacatg
aaaattatggatgcagctgattatgaagttagccaagcaattaaatttggcgcggatgta
attacaatactaggtgttgcagaagatgcatcaattaaagcagctattgaagaagctcat
aaaaataataaacaattactagttgatatgattgctgttcaagatttagaaaaacgtgca
aaagaactagatgaaatgggtgctgattatattgcagtacacactggttatgatttacaa
gcagaagggcaatcaccattagaaagtttaagaaccgttaaatctgttattaaaaattct
aaagttgcagtagcaggtggaattaaaccagatacaattaaagatattgtcgctgaaagt
cctgatcttgttattgttggtggcggaatcgcaaatgcagatgatccagtagaagctgca
aaacaatgtcgcgctgcaatcgaaggtaagtaa

DBGET integrated database retrieval system