KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0569Help
Entry
SAHV_0569         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K08094  
6-phospho-3-hexuloisomerase [EC:5.3.1.27]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Pentose phosphate pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Formaldehyde assimilation, ribulose monophosphate pathway
Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAHV_0569
  Energy metabolism
   00680 Methane metabolism
    SAHV_0569
Enzymes [BR:saw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.27  6-phospho-3-hexuloisomerase
     SAHV_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
649280..649828
Genome map
AA seq 182 aa AA seqDB search
MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQ
LGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIG
NLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHAN
LE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatttagtgactatcaattaattctagatgaattaaagatgactttgtcacat
gttgaagcggatgagttttcaacttttgcatccaaaatactacatgctgaacatatattt
gtagctggcaaaggacgttcaggattcgtggcgaatagttttgcaatgcgcttaaatcag
ctcggcaaacaggcacatgttgttggagaatcaacgacacctgcgattaagtcgaatgat
gtatttgtaattatctctggttcaggttccacggaacatttaagattattagcagacaaa
gcaaaatcagtaggtgctgacatcgtattaattactacaaataaagattctgcaataggc
aatctagctgggacgaacatcgttttgcctgcaggtacaaaatatgatgaacaaggctcg
gcacaaccattaggaagtttgtttgaacaagcatctcaattatttttagatagtgttgta
atgggattgatgactgaaatgaatgttacggaacaaacgatgcaacaaaatcatgctaat
ttagaataa

DBGET integrated database retrieval system