KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0576Help
Entry
SAHV_0576         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
655894..656163
Genome map
AA seq 89 aa AA seqDB search
MKFNEIWINEYLALVNDDNPIHNEIVPGQLVSQMMLMAMSLETNQCQINYVKPILINENI
EFIEQHEHEIIAINDDGEIKIKISLSTKK
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttaatgagatatggataaatgaatatttggcgctcgtaaatgatgataatcca
atacataatgagattgtgccaggacaattagtgagtcaaatgatgctgatggctatgtca
ttagagacaaaccagtgtcaaattaactacgttaaacctattttaataaatgaaaatatc
gaattcattgaacaacacgaacacgaaattatagcaattaatgacgatggagagattaaa
ataaaaatttctttgagcacaaaaaaataa

DBGET integrated database retrieval system