KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0585Help
Entry
SAHV_0585         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00435  
Fe-coproporphyrin III decarboxylase [EC:1.11.1.-]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAHV_0585
Enzymes [BR:saw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     SAHV_0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(663114..663866)
Genome map
AA seq 250 aa AA seqDB search
MSQAAETLDGWYSLHLFYAVDWASLRIVPKDERDALVTEFQSFLENTATVRSSKSGDQAI
YNITGQKADLLLWFLRPEMKSLNHIENEFNKLRIADFLIPTYSYVSVIELSNYLAGKSDE
DPYENPHIKARLYPELPHSDYICFYPMNKRRNETYNWYMLTMEERQKLMYDHGMIGRKYA
GKIKQFITGSVGFDDFEWGVTLFSDDVLQFKKIVYEMRFDETTARYGEFGSFFVGHLINT
NEFDQFFAIS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcagccgaaacattagatggttggtatagtctacatttattttatgcagtt
gattgggcatcattacgtatagttccaaaggacgaacgcgatgcacttgtcactgaattt
caatcatttttagaaaatacagcaactgtaagatcatcaaaatctggtgatcaagctatt
tataatataactggtcaaaaagcagatttgttattatggttcttacgtcctgaaatgaag
tctttaaatcatattgaaaatgaatttaacaaattgcgcattgctgacttcctaatccct
acatattcatatgtatcagtcattgaattgagcaattatttagctggtaaatctgatgaa
gatccttatgagaaccctcatatcaaagcaagattatacccagaattaccacattctgat
tatatttgtttctatccaatgaacaaacgtcgtaatgaaacttataactggtacatgtta
actatggaagaacgccaaaaattaatgtatgaccatggtatgattggtagaaaatatgct
ggcaaaatcaaacaatttattactggttctgtagggtttgatgatttcgaatggggcgta
acattgttctcagatgacgtattacaattcaaaaaaattgtatacgaaatgcgctttgat
gaaacaacagcacgatacggtgaattcggtagtttctttgtaggacatcttattaacaca
aacgaattcgatcaattctttgcgatttcttaa

DBGET integrated database retrieval system