KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0586Help
Entry
SAHV_0586         CDS       T00588                                 

Gene name
pta
Definition
(GenBank) phosphotransacetylase
  KO
K00625  
phosphate acetyltransferase [EC:2.3.1.8]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAHV_0586 (pta)
   00640 Propanoate metabolism
    SAHV_0586 (pta)
  Energy metabolism
   00680 Methane metabolism
    SAHV_0586 (pta)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SAHV_0586 (pta)
Enzymes [BR:saw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     SAHV_0586 (pta)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
664034..665020
Genome map
AA seq 328 aa AA seqDB search
MADLLNVLKDKLSGKNVKIVLPEGEDERVLTAATQLQATDYVTPIVLGDETKVQSLAQKL
DLDISNIELINPATSELKAELVQSFVERRKGKATEEQAQELLNNVNYFGTMLVYAGKADG
LVSGAAHSTGDTVRPALQIIKTKPGVSRTSGIFFMIKGDEQYIFGDCAINPELDSQGLAE
IAVESAKSALSFGMDPKVAMLSFSTKGSAKSDDVTKVQEAVKLAQQKAEEEKLEAIIDGE
FQFDAAIVPGVAEKKAPGAKLQGDANVFVFPSLEAGNIGYKIAQRLGGYDAVGPVLQGLN
SPVNDLSRGCSIEDVYNLSIITAAQALQ
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggctgatttattaaatgtattaaaagacaaactttctggtaaaaacgttaaaatcgta
ttacctgaaggagaggacgaacgtgttctaacagctgcaacacaattacaagcaacagat
tatgttacaccaatcgtgttaggtgatgagactaaggttcaatctttagcgcaaaaactt
gatcttgatatttctaatattgaattaattaatcctgcgacaagtgaattgaaagctgaa
ttagttcaatcatttgttgaacgacgtaaaggtaaagcgactgaagaacaagcacaagaa
ttattaaacaatgtgaactacttcggtacaatgcttgtttatgctggtaaagcagatggt
ttagttagtggtgcagcacattcaacaggagacactgtgcgtccagctttacaaatcatc
aaaacgaaaccaggtgtatcaagaacatcaggtatcttctttatgattaaaggtgatgaa
caatacatctttggtgattgtgcaatcaatccagaacttgattcacaaggacttgcagaa
attgcagtagaaagtgcaaaatcagcattaagctttggcatggatccaaaagttgcaatg
ttaagcttttcaacaaaagggtctgctaaatcagacgacgtgacaaaagttcaagaagct
gtcaaattagcacaacaaaaagctgaagaagaaaaattagaagcaatcattgatggcgaa
ttccaatttgatgctgcgattgtaccaggtgttgctgagaaaaaagcgccaggtgctaaa
ttacaaggtgatgcaaatgtctttgtattcccaagtttagaagctggtaatattggttac
aaaattgcacaacgtttaggtggatatgatgcagttggtccagtattacaaggtttaaat
tctccagtaaatgacttatcacgtggctgctcaattgaagatgtatacaatctttcaatt
attacagcagcgcaagccttacaataa

DBGET integrated database retrieval system