KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0606Help
Entry
SAHV_0606         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
  KO
K07457  
endonuclease III related protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
684881..685516
Genome map
AA seq 211 aa AA seqDB search
MLGTDELYKLLYRHMGPQNWWPADNDIELMLGAILVQNTRWRNAEIALNQIKEHTHFNPN
HILELPIETLQSLIHSSGFYKSKTLTIKTLLTWLARHHFNYQEINERYKGGLRKELLSLK
GIGSETADVLLVYIFGRIEFIPDSYTRKIYDKLGYENTKNYDQLKKVVTLPNHFTNQDAN
EFHALLDVFGKHYFRDKDIKNYDFLEPYFKK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgttaggaactgatgaattgtataaattgttatataggcatatgggaccgcaaaattgg
tggcctgctgataatgacattgaactgatgttaggtgcaattttagttcaaaatactaga
tggcgaaatgcagaaattgcattgaatcagattaaagaacatacgcattttaatcccaat
catatattagaactacctattgaaacgttacaatcattgatacattcaagtggcttttat
aaaagtaaaacactgacgattaaaacattattaacatggttagcacgacatcatttcaat
tatcaagagattaatgagcgatataaaggtggattaagaaaagaattattatctttgaaa
ggtattggaagtgaaacagcagatgtcttacttgtttatatattcggacgtattgaattt
attccagatagctatacaagaaaaatatatgataaattaggatatgaaaacactaaaaat
tatgatcaattaaaaaaagtagtcacattaccaaatcattttacaaatcaagatgctaat
gaatttcatgctctgttagatgtatttggtaaacattactttagagacaaagatataaag
aattatgattttttagaaccttactttaaaaagtaa

DBGET integrated database retrieval system