KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0611Help
Entry
SAHV_0611         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
689448..689954
Genome map
AA seq 168 aa AA seqDB search
MKKLLTASIIACSVVMGVGLVNTSAEAASGNSIDTVKQLIKGDQSLENVKIGESIKDVLT
KYKNPMYSYNEDGTEHYYEFHTKKGMLLVTTDGKKNNGKVTHISMMYNDANGPTYQAVKN
YVGKAVTHTEYSKVAGNFGYIEKGKTTYQFASAPKDKNIKLYRIDLEK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctactaacggcaagtataattgcatgttctgttgtaatgggagtaggctta
gtgaacactagtgccgaagcagcaagtggcaactctattgatactgttaaacaattaatt
aagggtgatcagtcattagaaaatgtgaaaattggcgaatctattaaagatgttttaact
aagtacaaaaatcctatgtattcttacaatgaagatggaactgaacattattacgaattc
catactaaaaaaggtatgttattagtaactactgatggtaagaaaaacaatggtaaagta
actcatatttcaatgatgtataatgatgctaatggtccaacatatcaagctgttaaaaat
tatgttggcaaagcagtaacacatacggaatatagcaaagttgctggtaattttggatat
attgaaaaaggcaaaacgacttatcaatttgcctcagcaccaaaagataaaaacataaaa
ttatatcgtattgatttggaaaaataa

DBGET integrated database retrieval system