KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0613Help
Entry
SAHV_0613         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
691001..691789
Genome map
AA seq 262 aa AA seqDB search
MNKVTINPQIQLTYQIEGKGDPIILLHGLDGNLAGFEDLQHQLASSYKVLTYDLRGHGKS
SKSESYDLNDHVEDLKILMEKLNIHEAHILGHDLGGVVAKLFTDKYAYRVKSLTTIASKK
DDLIHSFTQLLIQYQDDIAGFNKSEAYILLFSKLFRNQEKTMKWYQKQRIYSIKSEDDSA
VAIRSLILHKDEPMYLKKRTCVPTLLINGEHDPLIKDKNHFKLEAHFLNVTKKIFEHSGH
APHIEEPEAFMNYYLNFLKSVS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtcacaattaatcctcaaatccaattaacttatcaaattgaaggtaaaggg
gatcctataatattacttcatggattggatggtaatttagctggatttgaagatttgcaa
catcaactagcatcatcatataaagtacttacttacgatttaagaggtcatggcaagtct
tctaaaagtgaatcatacgatttaaacgatcacgttgaggatttaaaaattctaatggag
aagttaaatattcatgaggcacatattctaggacatgatttaggtggggtagttgctaag
ttatttacagataaatatgcttatcgtgtaaaatcattaactaccattgcatcgaagaaa
gatgacttaatacacagctttactcaattgttaatacaatatcaagatgatatagcgggt
tttaataagtctgaagcgtatattcttttattttctaaattgtttagaaatcaagagaag
acgatgaaatggtatcaaaaacaaagaatatatagcattaagtctgaggatgatagtgcg
gtggcaattcgttcattaattttgcataaagatgaacctatgtatttaaaaaaacgtaca
tgtgtacctactttgttaattaatggggaacatgatcctttgattaaagataagaatcat
tttaaattggaagcgcattttttaaatgttacgaaaaaaatcttcgaacattcaggacat
gcaccgcatattgaagaaccagaagcatttatgaattattatttaaattttttaaaaagc
gtatcataa

DBGET integrated database retrieval system