KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0614Help
Entry
SAHV_0614         CDS       T00588                                 

Gene name
sarA
Definition
(GenBank) staphylococcal accessory regulator A
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(692041..692415)
Genome map
AA seq 124 aa AA seqDB search
MAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHL
NYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANN
EIEL
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcaattacaaaaatcaatgattgctttgagttgttatcaatggtcacttatgctgac
aaattaaaaagtttaattaaaaaggaattttcaattagctttgaagaattcgctgtattg
acatacatcagcgaaaacaaagagaaagaatactatcttaaagatattattaatcattta
aactacaaacaaccacaagttgttaaagcagttaaaattttatctcaagaagattacttc
gataaaaaacgtaatgagcatgatgaaagaactgtattaattcttgttaatgcacaacaa
cgtaaaaaaatcgaatcattattgagtcgagtaaataaacgaatcactgaagcaaacaac
gaaattgaactataa

DBGET integrated database retrieval system