KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0617Help
Entry
SAHV_0617         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(694728..694931)
Genome map
AA seq 67 aa AA seqDB search
MSKINHITIVLSFTKVDANGKQTEFKRRFANINPDASNDQIKTFSKLIERLTGETYNNIE
LIKSLSI
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaataaaccacatcactattgtattatcatttactaaagtagacgctaacggc
aaacaaacagaatttaagcgtcgattcgctaacattaaccctgatgcatcaaacgaccaa
attaaaacattcagcaaacttattgagcgacttactggagaaacatataacaatatcgaa
ctcatcaaatctttatcaatttaa

DBGET integrated database retrieval system